IF1A - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

IF1A - Translation initiation factor 1A

UniProt:	Q97W62	Sequences: MPKKDRAQEAPSRDVPRPEEGQTICVVKKMLGGDHLIVLCMDGKERLARIPGKIRKKMWMREGDVVLVGIWDFQPNRCDILYKYGNDEIKRLVNENIISREVIDQLRG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	108 (93)
Sequences:	342 (180)
Seq/√Len:	18.7

HALSA - IF1A2 IF1A1
SULSO - IF1A

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
48_A	78_C	4.606	1.00
27_V	60_M	3.544	1.00
25_C	38_V	3.273	1.00
38_V	48_A	3.125	0.99
36_L	80_I	2.471	0.96
60_M	77_R	2.253	0.94
48_A	68_V	1.928	0.87
54_I	66_V	1.911	0.87
38_V	68_V	1.863	0.85
27_V	66_V	1.850	0.85
40_C	46_R	1.821	0.84
86_N	98_I	1.784	0.83
38_V	66_V	1.685	0.79
38_V	78_C	1.590	0.75
67_L	88_E	1.524	0.72
29_K	37_I	1.506	0.71
23_T	45_E	1.501	0.70
66_V	80_I	1.467	0.69
59_W	64_D	1.433	0.67
12_S	15_V	1.424	0.66
47_L	67_L	1.365	0.63
26_V	98_I	1.354	0.62
18_P	77_R	1.305	0.59
58_M	88_E	1.295	0.59
23_T	41_M	1.275	0.57
24_I	83_K	1.264	0.57
30_M	79_D	1.257	0.56
34_D	75_P	1.255	0.56
54_I	58_M	1.231	0.55
22_Q	87_D	1.205	0.53
67_L	94_N	1.203	0.53
25_C	44_K	1.189	0.52
9_E	81_L	1.174	0.51
58_M	82_Y	1.168	0.51
27_V	78_C	1.157	0.50
47_L	74_Q	1.133	0.49
17_R	95_E	1.130	0.48
28_K	39_L	1.129	0.48
37_I	45_E	1.116	0.47
13_R	88_E	1.095	0.46
49_R	71_W	1.090	0.46
78_C	89_I	1.087	0.46
56_K	89_I	1.079	0.45
80_I	98_I	1.076	0.45
35_H	62_E	1.070	0.45
36_L	50_I	1.058	0.44
57_K	83_K	1.051	0.43
31_L	96_N	1.043	0.43
42_D	46_R	1.040	0.43
24_I	71_W	1.039	0.43
38_V	53_K	1.028	0.42
60_M	81_L	1.018	0.41
16_P	22_Q	1.010	0.41
25_C	78_C	1.005	0.41
25_C	48_A	0.999	0.40
15_V	24_I	0.992	0.40
13_R	16_P	0.983	0.39
42_D	84_Y	0.974	0.39
31_L	41_M	0.936	0.36
31_L	35_H	0.917	0.35
24_I	97_I	0.903	0.35
43_G	72_D	0.892	0.34
27_V	36_L	0.891	0.34
81_L	94_N	0.872	0.33
53_K	73_F	0.865	0.32
56_K	59_W	0.864	0.32
25_C	75_P	0.853	0.32
47_L	80_I	0.843	0.31
27_V	77_R	0.840	0.31
29_K	44_K	0.833	0.31
31_L	47_L	0.821	0.30
70_I	83_K	0.818	0.30
67_L	87_D	0.810	0.30
13_R	67_L	0.809	0.29
50_I	74_Q	0.793	0.29
38_V	80_I	0.792	0.29
33_G	51_P	0.771	0.28
35_H	74_Q	0.766	0.27
54_I	81_L	0.764	0.27
19_E	69_G	0.746	0.26
51_P	71_W	0.745	0.26
30_M	35_H	0.743	0.26
14_D	91_R	0.738	0.26
35_H	72_D	0.731	0.26
58_M	86_N	0.724	0.25
48_A	55_R	0.724	0.25
39_L	60_M	0.722	0.25
47_L	55_R	0.691	0.24
17_R	20_E	0.683	0.23
15_V	97_I	0.680	0.23
20_E	89_I	0.680	0.23
65_V	83_K	0.671	0.23
24_I	90_K	0.663	0.22
8_Q	41_M	0.661	0.22
30_M	58_M	0.660	0.22
13_R	98_I	0.659	0.22
18_P	68_V	0.657	0.22
18_P	71_W	0.651	0.22
34_D	39_L	0.650	0.22
30_M	56_K	0.649	0.22
43_G	51_P	0.648	0.22
45_E	54_I	0.646	0.22
54_I	67_L	0.637	0.21
22_Q	79_D	0.626	0.21
8_Q	11_P	0.618	0.21
52_G	59_W	0.613	0.20
62_E	80_I	0.608	0.20
68_V	78_C	0.607	0.20
11_P	94_N	0.605	0.20
55_R	85_G	0.601	0.20
85_G	88_E	0.581	0.19
41_M	83_K	0.579	0.19
34_D	55_R	0.570	0.19
55_R	86_N	0.570	0.19
93_V	98_I	0.567	0.19
28_K	94_N	0.567	0.19
12_S	16_P	0.563	0.18
55_R	73_F	0.561	0.18
93_V	97_I	0.559	0.18
56_K	68_V	0.559	0.18
12_S	88_E	0.547	0.18
69_G	72_D	0.542	0.18
53_K	83_K	0.538	0.17
26_V	86_N	0.537	0.17
48_A	67_L	0.536	0.17
26_V	65_V	0.532	0.17
40_C	84_Y	0.531	0.17
61_R	91_R	0.530	0.17
33_G	56_K	0.526	0.17
63_G	96_N	0.521	0.17
69_G	73_F	0.520	0.17
54_I	59_W	0.515	0.17
17_R	23_T	0.513	0.17
57_K	90_K	0.512	0.17
60_M	78_C	0.511	0.17
26_V	51_P	0.510	0.16
50_I	59_W	0.508	0.16
21_G	37_I	0.502	0.16
51_P	69_G	0.501	0.16
55_R	91_R	0.500	0.16

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4kzyn	1	0.7593	100	0.323	Contact Map
3j80i	1	0.8889	100	0.324	Contact Map
4bpe0	1	0.9167	100	0.328	Contact Map
2oqkA	1	0.8611	100	0.355	Contact Map
4mnoA	1	0.8704	100	0.368	Contact Map
3wbkC	1	0.0093	100	0.37	Contact Map
1jt8A	1	0.9352	100	0.395	Contact Map
2dgyA	1	0.9444	100	0.403	Contact Map
4ql5A	4	0.6204	99.6	0.634	Contact Map
1ah9A	1	0.6481	99.6	0.635	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.