IF2B - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

IF2B - Translation initiation factor 2 subunit beta

UniProt:	Q97W59	Sequences: MSSEKEYVEMLDRLYSKLPEKGRKEGTQSLPNMIILNIGNTTIIRNFAEYCDRIRREDKICMKYLLKELAAPGNVDDKGELVIQGKFSSQVINTLMERFLKAYVECSTCKSLDTILKKEKKSWYIVCLACGAQTPVKPL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	139 (124)
Sequences:	618 (370)
Seq/√Len:	33.2

HALSA - IF2B
SULSO - IF2B

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
60_I	99_F	5.202	1.00
64_Y	98_R	4.971	1.00
27_T	112_L	4.541	1.00
38_I	80_E	3.216	1.00
47_F	62_M	3.212	1.00
47_F	61_C	3.033	1.00
115_I	128_L	2.773	1.00
116_L	125_I	2.679	1.00
66_L	73_G	2.424	0.99
31_P	53_R	2.126	0.99
33_M	93_N	1.927	0.97
55_R	128_L	1.870	0.97
31_P	49_E	1.862	0.97
36_L	43_I	1.726	0.95
105_E	112_L	1.716	0.95
56_R	114_T	1.715	0.95
94_T	103_Y	1.698	0.94
44_I	50_Y	1.689	0.94
43_I	80_E	1.605	0.93
56_R	104_V	1.591	0.92
70_A	103_Y	1.550	0.91
54_I	100_L	1.549	0.91
21_K	64_Y	1.507	0.90
126_V	133_Q	1.494	0.90
125_I	136_V	1.478	0.89
107_S	134_T	1.436	0.88
118_K	121_K	1.403	0.86
77_D	122_S	1.389	0.86
101_K	110_K	1.383	0.85
32_N	97_E	1.327	0.83
72_P	84_Q	1.306	0.82
116_L	136_V	1.303	0.82
28_Q	112_L	1.255	0.79
51_C	83_I	1.252	0.79
47_F	75_V	1.236	0.78
67_K	71_A	1.184	0.75
33_M	50_Y	1.182	0.75
20_E	52_D	1.181	0.75
110_K	126_V	1.179	0.75
101_K	125_I	1.155	0.73
104_V	116_L	1.151	0.73
122_S	132_A	1.148	0.73
50_Y	55_R	1.145	0.73
127_C	130_C	1.139	0.72
18_L	21_K	1.135	0.72
48_A	92_I	1.124	0.71
64_Y	90_Q	1.119	0.71
100_L	105_E	1.105	0.70
91_V	94_T	1.102	0.70
75_V	83_I	1.096	0.69
52_D	117_K	1.087	0.69
23_R	26_G	1.052	0.66
33_M	99_F	1.042	0.65
108_T	121_K	1.042	0.65
25_E	111_S	1.017	0.63
94_T	98_R	1.003	0.62
36_L	84_Q	0.999	0.62
36_L	45_R	0.998	0.62
65_L	92_I	0.972	0.60
78_K	116_L	0.970	0.60
55_R	115_I	0.962	0.59
27_T	113_D	0.953	0.58
60_I	71_A	0.948	0.58
81_L	111_S	0.935	0.57
116_L	135_P	0.930	0.56
34_I	45_R	0.923	0.56
119_E	133_Q	0.920	0.56
31_P	129_A	0.920	0.56
97_E	105_E	0.919	0.56
77_D	101_K	0.914	0.55
63_K	84_Q	0.904	0.54
115_I	126_V	0.895	0.54
21_K	58_D	0.890	0.53
88_S	121_K	0.880	0.52
61_C	104_V	0.878	0.52
35_I	92_I	0.876	0.52
35_I	89_S	0.875	0.52
22_G	33_M	0.871	0.52
51_C	62_M	0.859	0.51
74_N	83_I	0.842	0.49
31_P	131_G	0.840	0.49
47_F	107_S	0.834	0.48
27_T	131_G	0.833	0.48
72_P	129_A	0.831	0.48
83_I	107_S	0.825	0.48
70_A	82_V	0.824	0.48
112_L	131_G	0.819	0.47
49_E	93_N	0.811	0.47
66_L	83_I	0.809	0.46
47_F	103_Y	0.789	0.45
28_Q	54_I	0.788	0.45
28_Q	100_L	0.785	0.44
44_I	103_Y	0.771	0.43
85_G	106_C	0.771	0.43
94_T	121_K	0.767	0.43
47_F	118_K	0.765	0.43
40_N	133_Q	0.764	0.43
121_K	134_T	0.759	0.42
51_C	61_C	0.748	0.41
15_Y	22_G	0.748	0.41
16_S	21_K	0.746	0.41
120_K	124_Y	0.744	0.41
40_N	43_I	0.741	0.41
97_E	101_K	0.741	0.41
86_K	121_K	0.740	0.41
121_K	132_A	0.737	0.40
122_S	135_P	0.731	0.40
74_N	81_L	0.707	0.38
76_D	93_N	0.699	0.37
50_Y	75_V	0.696	0.37
44_I	135_P	0.695	0.37
40_N	116_L	0.691	0.37
125_I	135_P	0.687	0.36
51_C	84_Q	0.684	0.36
81_L	103_Y	0.683	0.36
70_A	80_E	0.682	0.36
71_A	85_G	0.682	0.36
17_K	29_S	0.681	0.36
83_I	92_I	0.681	0.36
24_K	76_D	0.674	0.35
132_A	135_P	0.671	0.35
73_G	118_K	0.671	0.35
23_R	29_S	0.668	0.35
23_R	28_Q	0.662	0.35
44_I	67_K	0.661	0.35
22_G	103_Y	0.658	0.34
54_I	96_M	0.647	0.33
33_M	135_P	0.647	0.33
19_P	131_G	0.643	0.33
38_I	108_T	0.640	0.33
76_D	82_V	0.636	0.33
29_S	100_L	0.631	0.32
76_D	80_E	0.628	0.32
121_K	124_Y	0.625	0.32
67_K	132_A	0.619	0.31
112_L	129_A	0.616	0.31
66_L	84_Q	0.614	0.31
26_G	113_D	0.611	0.31
59_K	75_V	0.605	0.30
14_L	31_P	0.602	0.30
76_D	116_L	0.601	0.30
81_L	99_F	0.598	0.30
64_Y	99_F	0.597	0.30
63_K	129_A	0.596	0.30
79_G	110_K	0.594	0.30
69_L	90_Q	0.593	0.30
68_E	95_L	0.590	0.29
17_K	137_K	0.589	0.29
47_F	66_L	0.587	0.29
77_D	136_V	0.586	0.29
59_K	134_T	0.582	0.29
103_Y	122_S	0.581	0.29
53_R	66_L	0.579	0.29
38_I	43_I	0.576	0.28
44_I	102_A	0.572	0.28
90_Q	122_S	0.571	0.28
44_I	65_L	0.569	0.28
110_K	120_K	0.565	0.28
93_N	110_K	0.565	0.28
82_V	86_K	0.563	0.28
65_L	87_F	0.561	0.27
42_T	79_G	0.557	0.27
39_G	112_L	0.555	0.27
17_K	23_R	0.553	0.27
80_E	99_F	0.549	0.27
63_K	75_V	0.547	0.26
89_S	93_N	0.543	0.26
36_L	119_E	0.542	0.26
78_K	101_K	0.542	0.26
57_E	82_V	0.538	0.26
19_P	129_A	0.536	0.26
65_L	105_E	0.535	0.26
63_K	117_K	0.534	0.26
35_I	69_L	0.530	0.25
34_I	74_N	0.527	0.25
38_I	70_A	0.518	0.25
37_N	65_L	0.517	0.25
30_L	79_G	0.511	0.24
51_C	54_I	0.510	0.24
39_G	71_A	0.508	0.24
30_L	97_E	0.504	0.24
30_L	64_Y	0.503	0.24
32_N	93_N	0.501	0.24
107_S	132_A	0.501	0.24
55_R	126_V	0.501	0.24
37_N	86_K	0.500	0.24

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3cw2K	1	0.9928	100	0.035	Contact Map
2d74B	1	0.9712	100	0.062	Contact Map
3j81l	1	0.1223	100	0.075	Contact Map
1neeA	1	0.9712	100	0.082	Contact Map
2g2kA	1	0.9137	100	0.195	Contact Map
2e9hA	1	0.964	100	0.202	Contact Map
1k8bA	1	0.3741	99.7	0.639	Contact Map
1k81A	1	0.259	99.2	0.744	Contact Map
4bpeF	1	0.5755	79.1	0.912	Contact Map
2js4A	1	0.295	75.8	0.915	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.