Q97W58 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97W58 - Uncharacterized protein

UniProt:	Q97W58	Sequences: MSSMWRSNTSETTMKVLLNIIRAQGMTLINICQEELLGKVFREGEIILDISEKFYGGESVELDYALSLIDEATVMSIVGNYAVEEAIRRGLVHKDSVINVAGIKFAQVYNV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	111 (94)
Sequences:	160 (124)
Seq/√Len:	12.8

HALSA - Q9HMM7
SULSO - Q97W58

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
29_I	72_A	3.291	0.98
80_N	104_K	3.195	0.98
92_V	106_A	2.881	0.95
31_I	65_A	2.680	0.93
77_I	82_A	2.659	0.93
55_Y	105_F	2.604	0.92
85_E	89_R	2.139	0.82
16_V	29_I	2.107	0.81
60_V	65_A	2.018	0.78
20_I	39_K	1.825	0.70
77_I	102_G	1.823	0.70
16_V	65_A	1.656	0.62
17_L	30_N	1.562	0.58
30_N	105_F	1.529	0.56
64_Y	67_S	1.518	0.55
24_Q	61_E	1.463	0.53
36_L	96_S	1.455	0.52
40_V	52_E	1.448	0.52
31_I	83_V	1.441	0.51
40_V	49_D	1.427	0.51
55_Y	90_G	1.418	0.50
35_E	81_Y	1.416	0.50
19_N	30_N	1.365	0.47
77_I	86_A	1.312	0.45
93_H	96_S	1.311	0.45
36_L	45_E	1.290	0.44
18_L	44_G	1.267	0.42
32_C	72_A	1.260	0.42
64_Y	69_I	1.248	0.41
21_I	30_N	1.243	0.41
34_E	59_S	1.233	0.41
72_A	75_M	1.214	0.40
28_L	101_A	1.190	0.39
59_S	65_A	1.187	0.38
54_F	107_Q	1.176	0.38
20_I	88_R	1.171	0.38
23_A	26_M	1.163	0.37
33_Q	76_S	1.100	0.34
41_F	48_L	1.097	0.34
36_L	104_K	1.083	0.33
20_I	23_A	1.074	0.33
16_V	85_E	1.053	0.32
65_A	71_E	1.050	0.32
41_F	109_Y	1.024	0.31
63_D	67_S	1.016	0.30
43_E	46_I	1.009	0.30
29_I	32_C	1.005	0.30
21_I	28_L	0.992	0.29
60_V	64_Y	0.987	0.29
63_D	73_T	0.970	0.28
60_V	84_E	0.961	0.28
35_E	63_D	0.961	0.28
40_V	47_I	0.960	0.28
24_Q	70_D	0.958	0.28
54_F	106_A	0.936	0.27
33_Q	105_F	0.930	0.27
49_D	95_D	0.924	0.27
19_N	41_F	0.920	0.26
18_L	65_A	0.914	0.26
40_V	69_I	0.896	0.25
86_A	106_A	0.886	0.25
60_V	103_I	0.884	0.25
77_I	95_D	0.883	0.25
54_F	86_A	0.877	0.25
16_V	72_A	0.877	0.25
62_L	85_E	0.876	0.25
34_E	81_Y	0.874	0.25
21_I	109_Y	0.868	0.24
52_E	56_G	0.864	0.24
37_L	90_G	0.862	0.24
16_V	62_L	0.861	0.24
27_T	58_E	0.858	0.24
46_I	51_S	0.852	0.24
23_A	74_V	0.850	0.24
32_C	37_L	0.847	0.24
36_L	74_V	0.837	0.23
55_Y	107_Q	0.835	0.23
48_L	78_V	0.822	0.23
44_G	57_G	0.818	0.22
19_N	36_L	0.814	0.22
26_M	74_V	0.802	0.22
75_M	93_H	0.801	0.22
65_A	82_A	0.800	0.22
80_N	84_E	0.797	0.22
23_A	28_L	0.778	0.21
29_I	65_A	0.774	0.21
54_F	105_F	0.769	0.21
50_I	96_S	0.769	0.21
30_N	54_F	0.758	0.20
41_F	89_R	0.758	0.20
60_V	68_L	0.741	0.20
30_N	68_L	0.736	0.20
46_I	87_I	0.732	0.20
27_T	71_E	0.721	0.19
37_L	78_V	0.718	0.19
61_E	65_A	0.712	0.19
38_G	90_G	0.711	0.19
19_N	80_N	0.700	0.19
63_D	66_L	0.683	0.18
54_F	72_A	0.674	0.18
86_A	107_Q	0.669	0.18
36_L	41_F	0.663	0.17
86_A	92_V	0.659	0.17
34_E	95_D	0.653	0.17
65_A	83_V	0.652	0.17
36_L	95_D	0.649	0.17
42_R	51_S	0.639	0.17
18_L	60_V	0.638	0.17
77_I	84_E	0.632	0.16
18_L	30_N	0.631	0.16
81_Y	97_V	0.623	0.16
34_E	40_V	0.614	0.16
77_I	103_I	0.614	0.16
21_I	74_V	0.612	0.16
41_F	46_I	0.608	0.16
58_E	95_D	0.597	0.16
48_L	66_L	0.597	0.16
75_M	108_V	0.596	0.15
47_I	72_A	0.590	0.15
70_D	91_L	0.585	0.15
58_E	97_V	0.584	0.15
43_E	99_N	0.583	0.15
39_K	101_A	0.582	0.15
66_L	89_R	0.572	0.15
36_L	97_V	0.571	0.15
64_Y	84_E	0.563	0.15
50_I	78_V	0.560	0.15
50_I	98_I	0.557	0.14
45_E	49_D	0.552	0.14
53_K	94_K	0.538	0.14
95_D	109_Y	0.537	0.14
34_E	83_V	0.537	0.14
51_S	69_I	0.534	0.14
31_I	82_A	0.533	0.14
60_V	100_V	0.530	0.14
63_D	69_I	0.530	0.14
50_I	108_V	0.519	0.14
53_K	60_V	0.509	0.13
30_N	76_S	0.507	0.13
98_I	105_F	0.502	0.13
94_K	103_I	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2qyaA	2	0.8829	100	0.208	Contact Map
4wweA	1	0.4054	22.4	0.932	Contact Map
4wwtA	1	0.4054	21.4	0.932	Contact Map
3r07C	1	0.7477	15.8	0.936	Contact Map
1rm6B	1	0.5766	15.4	0.936	Contact Map
2ov7A	1	0.5856	11.3	0.94	Contact Map
1t3qC	1	0.5676	10.2	0.941	Contact Map
1n62C	1	0.5676	8.4	0.944	Contact Map
3r8eA	2	0.7658	8	0.944	Contact Map
4k0mC	1	0.4144	7.9	0.944	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.