Q97W50 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97W50 - Uncharacterized protein

UniProt:	Q97W50	Sequences: MKLERLLEGAKNLVRTGWMQNGIPSAMGETVASHSFEASILAYVLATELKRKGIEINPEHSALIALFHDAGETLLGDLPKWATSRINKRDAEVEAFDELGIGKELFLELKDLNTNEAKVAKLSDRLSTYLQGLRYKRIGFNVDEIISSYAEEIDKLLSIEPLNQIRELVTRIMNSLNKLNPK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	182 (162)
Sequences:	1506 (1052)
Seq/√Len:	82.6

ECOLI - 5DNU
HALSA - O52019
SULSO - Q97W50

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
97_D	103_K	4.061	1.00
74_L	98_E	3.551	1.00
107_L	111_D	3.214	1.00
93_V	107_L	2.644	1.00
37_E	134_R	2.603	1.00
143_D	147_S	2.584	1.00
90_D	94_E	2.560	1.00
38_A	65_A	2.537	1.00
7_L	70_A	2.460	1.00
30_T	33_S	2.446	1.00
8_E	37_E	2.182	1.00
7_L	40_I	2.181	1.00
109_L	120_A	2.129	1.00
103_K	107_L	2.125	1.00
108_E	114_T	2.121	1.00
59_E	63_L	2.108	1.00
6_L	74_L	2.057	1.00
155_K	158_S	1.995	1.00
41_L	123_S	1.975	1.00
112_L	121_K	1.973	1.00
42_A	65_A	1.791	1.00
71_G	96_F	1.784	1.00
127_S	131_Q	1.746	1.00
61_S	65_A	1.708	1.00
96_F	100_G	1.690	1.00
42_A	123_S	1.625	1.00
18_W	135_Y	1.618	1.00
43_Y	63_L	1.598	1.00
158_S	161_P	1.594	1.00
21_N	24_P	1.591	1.00
55_E	115_N	1.584	1.00
38_A	123_S	1.575	1.00
39_S	66_L	1.559	1.00
59_E	62_A	1.536	1.00
112_L	117_A	1.477	0.99
57_N	60_H	1.474	0.99
61_S	116_E	1.470	0.99
30_T	127_S	1.468	0.99
87_N	91_A	1.467	0.99
4_E	41_L	1.444	0.99
35_S	38_A	1.439	0.99
65_A	120_A	1.438	0.99
46_A	58_P	1.424	0.99
58_P	62_A	1.417	0.99
149_Y	153_I	1.409	0.99
82_A	91_A	1.403	0.99
10_A	31_V	1.390	0.99
162_L	166_R	1.371	0.99
142_V	146_I	1.367	0.99
142_V	145_I	1.365	0.99
131_Q	135_Y	1.352	0.99
6_L	9_G	1.336	0.99
151_E	154_D	1.332	0.99
163_N	167_E	1.320	0.99
37_E	127_S	1.310	0.98
142_V	147_S	1.299	0.98
10_A	35_S	1.288	0.98
67_F	105_L	1.277	0.98
104_E	107_L	1.270	0.98
7_L	66_L	1.265	0.98
93_V	97_D	1.245	0.98
42_A	61_S	1.237	0.98
54_I	115_N	1.207	0.97
143_D	146_I	1.201	0.97
137_R	140_F	1.168	0.97
88_K	121_K	1.156	0.97
85_R	88_K	1.144	0.96
164_Q	167_E	1.141	0.96
17_G	135_Y	1.112	0.96
60_H	116_E	1.110	0.96
33_S	127_S	1.102	0.95
16_T	79_P	1.097	0.95
141_N	144_E	1.097	0.95
20_Q	131_Q	1.082	0.95
57_N	116_E	1.070	0.95
11_K	131_Q	1.059	0.94
64_I	114_T	1.058	0.94
105_L	108_E	1.050	0.94
79_P	82_A	1.047	0.94
43_Y	106_F	1.043	0.94
115_N	119_V	1.031	0.93
50_K	54_I	1.020	0.93
97_D	107_L	1.006	0.93
92_E	95_A	1.004	0.93
56_I	61_S	1.003	0.93
92_E	99_L	0.998	0.92
56_I	119_V	0.996	0.92
149_Y	152_E	0.988	0.92
89_R	93_V	0.969	0.91
50_K	55_E	0.965	0.91
43_Y	67_F	0.964	0.91
144_E	148_S	0.958	0.91
45_L	61_S	0.952	0.90
74_L	99_L	0.950	0.90
18_W	26_A	0.943	0.90
35_S	39_S	0.921	0.89
65_A	109_L	0.914	0.89
151_E	163_N	0.912	0.88
18_W	131_Q	0.906	0.88
64_I	117_A	0.900	0.88
132_G	135_Y	0.891	0.87
8_E	134_R	0.891	0.87
84_S	87_N	0.879	0.87
67_F	70_A	0.874	0.86
166_R	169_V	0.873	0.86
14_V	26_A	0.865	0.86
158_S	165_I	0.863	0.86
98_E	101_I	0.863	0.86
150_A	153_I	0.854	0.85
64_I	108_E	0.850	0.85
25_S	33_S	0.850	0.85
135_Y	139_G	0.843	0.84
108_E	113_N	0.834	0.84
13_L	31_V	0.824	0.83
43_Y	62_A	0.824	0.83
141_N	145_I	0.819	0.82
49_L	119_V	0.811	0.82
112_L	125_R	0.808	0.82
115_N	118_K	0.808	0.82
46_A	59_E	0.799	0.81
109_L	121_K	0.793	0.80
4_E	81_W	0.791	0.80
142_V	149_Y	0.790	0.80
119_V	123_S	0.784	0.80
122_L	158_S	0.782	0.79
40_I	67_F	0.782	0.79
93_V	103_K	0.777	0.79
58_P	61_S	0.777	0.79
13_L	30_T	0.776	0.79
60_H	64_I	0.776	0.79
158_S	162_L	0.773	0.79
145_I	148_S	0.763	0.78
64_I	67_F	0.754	0.77
155_K	168_L	0.747	0.76
9_G	12_N	0.745	0.76
161_P	166_R	0.744	0.76
50_K	116_E	0.735	0.75
50_K	56_I	0.732	0.75
61_S	120_A	0.731	0.75
38_A	85_R	0.731	0.75
41_L	127_S	0.730	0.75
87_N	90_D	0.724	0.74
21_N	144_E	0.721	0.74
88_K	135_Y	0.720	0.74
132_G	140_F	0.709	0.72
162_L	169_V	0.709	0.72
106_F	110_K	0.708	0.72
14_V	18_W	0.704	0.72
64_I	116_E	0.701	0.72
122_L	155_K	0.690	0.70
15_R	29_E	0.689	0.70
14_V	25_S	0.686	0.70
41_L	126_L	0.678	0.69
20_Q	125_R	0.674	0.69
95_A	98_E	0.672	0.68
17_G	128_T	0.664	0.67
68_H	72_E	0.663	0.67
71_G	75_L	0.659	0.67
12_N	21_N	0.659	0.67
159_I	168_L	0.659	0.67
22_G	130_L	0.652	0.66
121_K	125_R	0.641	0.65
64_I	105_L	0.640	0.65
12_N	30_T	0.637	0.64
146_I	149_Y	0.635	0.64
86_I	89_R	0.634	0.64
152_E	155_K	0.629	0.63
38_A	41_L	0.627	0.63
3_L	95_A	0.622	0.62
153_I	156_L	0.620	0.62
18_W	31_V	0.620	0.62
2_K	111_D	0.616	0.62
17_G	31_V	0.613	0.61
42_A	62_A	0.612	0.61
88_K	109_L	0.611	0.61
157_L	161_P	0.606	0.60
18_W	22_G	0.606	0.60
84_S	88_K	0.605	0.60
18_W	29_E	0.604	0.60
135_Y	138_I	0.603	0.60
144_E	147_S	0.601	0.60
2_K	168_L	0.600	0.60
12_N	20_Q	0.598	0.59
150_A	166_R	0.598	0.59
95_A	106_F	0.594	0.59
11_K	32_A	0.594	0.59
42_A	119_V	0.592	0.59
78_L	91_A	0.588	0.58
99_L	102_G	0.588	0.58
20_Q	130_L	0.586	0.58
16_T	26_A	0.586	0.58
33_S	106_F	0.585	0.58
12_N	134_R	0.584	0.58
85_R	121_K	0.579	0.57
159_I	166_R	0.578	0.57
73_T	99_L	0.576	0.57
71_G	95_A	0.570	0.56
17_G	26_A	0.568	0.55
48_E	58_P	0.567	0.55
80_K	121_K	0.566	0.55
8_E	31_V	0.566	0.55
143_D	148_S	0.563	0.55
128_T	132_G	0.561	0.55
67_F	100_G	0.559	0.54
78_L	81_W	0.558	0.54
35_S	69_D	0.556	0.54
118_K	159_I	0.556	0.54
40_I	66_L	0.552	0.53
36_F	40_I	0.549	0.53
33_S	36_F	0.548	0.53
93_V	102_G	0.545	0.52
17_G	131_Q	0.543	0.52
69_D	72_E	0.542	0.52
148_S	151_E	0.542	0.52
126_L	161_P	0.537	0.51
79_P	127_S	0.536	0.51
91_A	98_E	0.536	0.51
17_G	50_K	0.534	0.51
5_R	134_R	0.533	0.51
58_P	63_L	0.532	0.51
75_L	81_W	0.532	0.51
6_L	98_E	0.532	0.51
81_W	128_T	0.531	0.51
62_A	65_A	0.523	0.50
18_W	138_I	0.520	0.49
98_E	102_G	0.519	0.49
159_I	165_I	0.517	0.49
19_M	71_G	0.516	0.49
111_D	114_T	0.516	0.49
79_P	125_R	0.513	0.48
144_E	149_Y	0.512	0.48
5_R	130_L	0.511	0.48
36_F	66_L	0.509	0.48
60_H	160_E	0.507	0.47
22_G	134_R	0.507	0.47
89_R	112_L	0.506	0.47
133_L	137_R	0.506	0.47
43_Y	66_L	0.505	0.47
63_L	67_F	0.504	0.47
91_A	94_E	0.503	0.47
17_G	79_P	0.503	0.47
64_I	109_L	0.501	0.47
155_K	161_P	0.500	0.47

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1xx7A	5	0.9286	100	0.268	Contact Map
4l1jA	2	0.9341	100	0.277	Contact Map
1ynbA	5	0.8626	100	0.285	Contact Map
3kh1A	2	0.9396	100	0.339	Contact Map
2cqzA	5	0.9341	100	0.354	Contact Map
3mzoA	5	0.978	100	0.414	Contact Map
2paqA	5	0.8846	100	0.438	Contact Map
2gz4A	2	0.9121	100	0.476	Contact Map
3dtoA	2	0.8242	97.5	0.848	Contact Map
3b57A	2	0.8462	97.4	0.85	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.