Q97W37 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97W37 - Uncharacterized protein

UniProt:	Q97W37	Sequences: MVLKYFGHSCVLIDDRILIDPHDGGSIGLPKPDIKKVDLILVTHDHYDHNAYQIFEYKDVKINFYGSLTYSNYTIKGIKSYHDKYNGKLRGENSIYVLQRSDGKKIVHLGDLGHLLEENTYKELYGADVLLIPIGGVITINFKEALEIINKISPKIIIPIHYWIKGHYMPLDPPEEFLANLKYEIRRIDLKNNLIDENVEESKKVVYALSY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	211 (181)
Sequences:	5002 (3345)
Seq/√Len:	248.6

ECOLI - ULAG
BACSU - YTKL YDDR
HALSA - Q9HR59 Y1038 Q9HR33
SULSO - Q97W37 Y099

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
11_V	160_I	3.609	1.00
77_G	94_S	3.495	1.00
99_Q	105_K	3.208	1.00
149_I	157_I	3.033	1.00
74_T	99_Q	2.842	1.00
130_L	154_P	2.740	1.00
78_I	97_V	2.683	1.00
43_T	108_H	2.560	1.00
143_K	180_N	2.387	1.00
17_I	39_L	2.371	1.00
140_I	148_I	2.314	1.00
19_I	43_T	2.292	1.00
97_V	127_A	2.259	1.00
114_H	151_K	2.250	1.00
131_L	158_I	2.241	1.00
128_D	155_K	2.193	1.00
76_K	99_Q	2.152	1.00
106_I	131_L	2.114	1.00
119_N	123_E	2.094	1.00
2_V	14_D	2.092	1.00
109_L	133_P	2.015	1.00
136_G	141_N	2.006	1.00
12_L	16_R	1.996	1.00
24_G	51_A	1.993	1.00
30_P	33_D	1.914	1.00
11_V	131_L	1.902	1.00
149_I	154_P	1.861	1.00
78_I	95_I	1.855	1.00
119_N	151_K	1.817	1.00
41_L	96_Y	1.743	1.00
41_L	98_L	1.704	1.00
67_S	74_T	1.692	1.00
175_E	179_A	1.686	1.00
15_D	101_S	1.670	1.00
147_E	150_N	1.657	1.00
109_L	132_I	1.572	1.00
176_E	180_N	1.567	1.00
147_E	151_K	1.553	1.00
69_T	74_T	1.527	1.00
131_L	160_I	1.526	1.00
3_L	129_V	1.429	1.00
141_N	144_E	1.399	1.00
39_L	61_K	1.397	1.00
19_I	98_L	1.396	1.00
134_I	145_A	1.384	1.00
129_V	158_I	1.378	1.00
122_K	153_S	1.363	1.00
52_Y	56_E	1.360	1.00
108_H	160_I	1.341	1.00
19_I	108_H	1.328	1.00
51_A	54_I	1.283	1.00
41_L	75_I	1.282	1.00
174_P	177_F	1.263	1.00
6_F	10_C	1.262	1.00
39_L	63_N	1.251	1.00
4_K	14_D	1.242	1.00
105_K	127_A	1.228	1.00
75_I	96_Y	1.218	1.00
6_F	12_L	1.216	1.00
13_I	19_I	1.198	1.00
97_V	124_L	1.170	1.00
77_G	96_Y	1.166	1.00
76_K	124_L	1.149	1.00
180_N	183_Y	1.138	1.00
109_L	130_L	1.134	1.00
129_V	156_I	1.127	1.00
18_L	37_V	1.123	1.00
118_E	148_I	1.115	1.00
10_C	19_I	1.114	1.00
3_L	11_V	1.109	1.00
39_L	70_Y	1.105	1.00
13_I	106_I	1.099	1.00
145_A	157_I	1.094	1.00
40_I	62_I	1.093	1.00
61_K	65_Y	1.088	1.00
63_N	96_Y	1.073	1.00
67_S	76_K	1.066	1.00
95_I	109_L	1.063	1.00
149_I	181_L	1.055	1.00
6_F	28_G	1.044	1.00
3_L	131_L	1.038	1.00
66_G	70_Y	1.036	1.00
137_V	167_H	1.033	1.00
80_S	95_I	1.032	1.00
23_D	31_K	1.024	1.00
120_T	123_E	1.015	1.00
44_H	111_D	1.008	1.00
58_K	61_K	1.007	1.00
132_I	148_I	1.003	1.00
19_I	41_L	0.996	1.00
146_L	184_E	0.992	1.00
69_T	72_N	0.991	1.00
16_R	36_K	0.985	1.00
12_L	37_V	0.975	1.00
132_I	152_I	0.972	1.00
179_A	183_Y	0.970	1.00
105_K	125_Y	0.967	1.00
34_I	37_V	0.952	1.00
104_K	128_D	0.943	1.00
101_S	104_K	0.936	1.00
176_E	179_A	0.935	1.00
39_L	75_I	0.932	1.00
168_Y	172_D	0.929	1.00
172_D	177_F	0.924	1.00
59_D	65_Y	0.919	1.00
132_I	140_I	0.913	1.00
22_H	27_I	0.907	1.00
16_R	38_D	0.906	1.00
23_D	54_I	0.904	1.00
130_L	152_I	0.901	1.00
178_L	182_K	0.899	1.00
114_H	147_E	0.893	1.00
107_V	148_I	0.888	1.00
85_Y	89_L	0.881	1.00
175_E	178_L	0.874	1.00
156_I	159_P	0.870	0.99
180_N	184_E	0.869	0.99
17_I	75_I	0.866	0.99
162_Y	178_L	0.866	0.99
65_Y	94_S	0.855	0.99
98_L	106_I	0.854	0.99
67_S	70_Y	0.853	0.99
12_L	18_L	0.852	0.99
17_I	73_Y	0.851	0.99
130_L	149_I	0.847	0.99
41_L	94_S	0.846	0.99
6_F	23_D	0.843	0.99
80_S	112_L	0.840	0.99
5_Y	160_I	0.831	0.99
78_I	107_V	0.824	0.99
95_I	107_V	0.822	0.99
173_P	176_E	0.822	0.99
46_H	111_D	0.822	0.99
49_H	111_D	0.822	0.99
97_V	121_Y	0.818	0.99
150_N	184_E	0.814	0.99
83_D	88_K	0.814	0.99
15_D	73_Y	0.810	0.99
45_D	90_R	0.809	0.99
134_I	162_Y	0.807	0.99
105_K	128_D	0.806	0.99
16_R	37_V	0.805	0.99
124_L	127_A	0.797	0.99
10_C	22_H	0.786	0.99
172_D	176_E	0.785	0.99
44_H	161_H	0.784	0.99
173_P	177_F	0.782	0.99
11_V	158_I	0.780	0.99
10_C	23_D	0.779	0.99
135_G	139_T	0.779	0.99
132_I	149_I	0.776	0.99
3_L	158_I	0.774	0.99
142_F	172_D	0.773	0.99
62_I	65_Y	0.770	0.99
146_L	150_N	0.770	0.99
9_S	133_P	0.769	0.99
109_L	112_L	0.758	0.99
15_D	102_D	0.758	0.99
32_P	57_Y	0.756	0.99
111_D	161_H	0.755	0.99
31_K	54_I	0.754	0.99
53_Q	57_Y	0.754	0.99
65_Y	96_Y	0.749	0.98
141_N	145_A	0.749	0.98
31_K	57_Y	0.746	0.98
4_K	12_L	0.743	0.98
46_H	49_H	0.741	0.98
44_H	49_H	0.734	0.98
60_V	65_Y	0.731	0.98
112_L	118_E	0.725	0.98
85_Y	88_K	0.721	0.98
154_P	157_I	0.721	0.98
81_Y	115_L	0.721	0.98
52_Y	55_F	0.719	0.98
29_L	34_I	0.718	0.98
50_N	55_F	0.717	0.98
98_L	101_S	0.708	0.98
116_L	119_N	0.698	0.98
66_G	69_T	0.697	0.98
9_S	160_I	0.696	0.98
76_K	125_Y	0.693	0.97
70_Y	73_Y	0.692	0.97
117_E	120_T	0.690	0.97
142_F	146_L	0.689	0.97
122_K	127_A	0.688	0.97
116_L	120_T	0.670	0.97
159_P	162_Y	0.666	0.97
45_D	91_G	0.659	0.97
138_I	141_N	0.654	0.96
43_T	96_Y	0.646	0.96
87_G	90_R	0.645	0.96
136_G	172_D	0.642	0.96
133_P	141_N	0.637	0.96
146_L	180_N	0.635	0.96
15_D	104_K	0.632	0.96
37_V	55_F	0.628	0.96
5_Y	162_Y	0.625	0.95
114_H	118_E	0.624	0.95
146_L	181_L	0.624	0.95
106_I	129_V	0.623	0.95
126_G	155_K	0.622	0.95
112_L	140_I	0.616	0.95
144_E	147_E	0.613	0.95
136_G	167_H	0.609	0.95
118_E	121_Y	0.607	0.95
179_A	182_K	0.605	0.95
108_H	133_P	0.602	0.94
49_H	161_H	0.599	0.94
29_L	33_D	0.597	0.94
61_K	64_F	0.595	0.94
182_K	185_I	0.595	0.94
63_N	70_Y	0.595	0.94
42_V	50_N	0.594	0.94
83_D	89_L	0.591	0.94
55_F	62_I	0.591	0.94
59_D	63_N	0.590	0.94
83_D	91_G	0.589	0.94
13_I	17_I	0.587	0.94
59_D	62_I	0.586	0.94
108_H	131_L	0.583	0.93
165_K	168_Y	0.582	0.93
97_V	105_K	0.582	0.93
127_A	130_L	0.574	0.93
122_K	130_L	0.572	0.93
105_K	126_G	0.572	0.93
75_I	98_L	0.570	0.93
181_L	185_I	0.570	0.93
59_D	64_F	0.570	0.93
8_H	47_Y	0.568	0.92
97_V	107_V	0.566	0.92
48_D	161_H	0.562	0.92
142_F	176_E	0.562	0.92
107_V	152_I	0.562	0.92
137_V	144_E	0.560	0.92
44_H	48_D	0.560	0.92
146_L	157_I	0.557	0.92
134_I	159_P	0.556	0.92
104_K	129_V	0.547	0.91
64_F	96_Y	0.547	0.91
79_K	92_E	0.546	0.91
157_I	181_L	0.543	0.91
163_W	169_M	0.543	0.91
15_D	103_G	0.541	0.91
5_Y	163_W	0.541	0.91
148_I	152_I	0.540	0.91
138_I	169_M	0.540	0.91
177_F	181_L	0.540	0.91
36_K	58_K	0.537	0.90
98_L	108_H	0.532	0.90
12_L	29_L	0.532	0.90
133_P	145_A	0.532	0.90
6_F	158_I	0.531	0.90
84_K	91_G	0.530	0.90
15_D	98_L	0.528	0.90
174_P	178_L	0.527	0.89
163_W	168_Y	0.523	0.89
138_I	180_N	0.518	0.89
79_K	121_Y	0.515	0.88
44_H	82_H	0.515	0.88
166_G	169_M	0.511	0.88
137_V	177_F	0.510	0.88
97_V	125_Y	0.509	0.88
58_K	63_N	0.508	0.88
5_Y	11_V	0.506	0.87
81_Y	113_G	0.504	0.87
58_K	62_I	0.504	0.87
37_V	58_K	0.503	0.87
63_N	75_I	0.503	0.87
146_L	185_I	0.502	0.87
80_S	107_V	0.502	0.87
150_N	153_S	0.501	0.87
45_D	50_N	0.500	0.87

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4qn9A	2	0.9716	100	0.438	Contact Map
3rpcA	2	0.9384	100	0.459	Contact Map
1vjnA	1	0.9005	100	0.504	Contact Map
3bv6A	5	0.9858	100	0.524	Contact Map
4jo0A	2	0.9336	100	0.544	Contact Map
2wylA	5	0.9668	100	0.549	Contact Map
3kl7A	1	0.8531	100	0.555	Contact Map
2cbnA	2	0.8815	99.9	0.615	Contact Map
1zkpA	2	0.872	99.9	0.628	Contact Map
1y44A	2	0.8957	99.9	0.631	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.