Q97W35 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97W35 - 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase

UniProt:	Q97W35	Sequences: MIRSWFGFKERDDYISASILNYLITKEYDEAELKELIKGREIAIVGAGPQLDKINKLKEDVIIAADGAANYLVDIGIVPDIIVTDLDGLQTFPKNPIYVVLAHGDNINLLHKVKEMDKVIPNSQVMPFGRLRLYGGFTDGDRAVVLAKYMKASKIRLYAMDFQSGIVGKFSKPYYQRNVPASMIKRKKLEIARMIIEQVLNYNE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	204 (184)
Sequences:	214 (165)
Seq/√Len:	12.1

HALSA - Q9HQ39
SULSO - Q97W35

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
19_I	107_I	5.389	1.00
100_V	116_M	4.140	1.00
3_R	125_V	3.443	0.98
5_W	191_I	3.380	0.98
12_D	15_I	3.077	0.96
10_E	14_Y	3.039	0.96
23_L	113_V	2.970	0.96
145_V	195_I	2.962	0.95
66_D	88_G	2.619	0.91
24_I	121_P	2.506	0.89
43_A	60_D	2.465	0.89
47_A	160_M	2.437	0.88
3_R	10_E	2.377	0.87
3_R	14_Y	2.244	0.83
72_L	77_I	2.235	0.83
6_F	17_A	2.135	0.80
41_E	154_K	2.070	0.78
64_A	72_L	2.047	0.77
14_Y	125_V	2.016	0.76
100_V	110_L	2.013	0.76
20_L	113_V	2.010	0.75
67_G	88_G	1.984	0.74
63_I	81_I	1.905	0.71
193_R	197_E	1.905	0.71
82_I	88_G	1.904	0.71
50_Q	160_M	1.887	0.71
84_T	127_P	1.881	0.70
84_T	143_A	1.782	0.66
86_L	100_V	1.778	0.66
5_W	187_K	1.772	0.66
7_G	151_K	1.724	0.63
5_W	162_F	1.693	0.62
145_V	198_Q	1.658	0.60
168_G	182_S	1.615	0.58
73_V	94_K	1.554	0.55
64_A	69_A	1.548	0.55
8_F	12_D	1.541	0.54
66_D	157_L	1.533	0.54
83_V	146_L	1.528	0.54
150_M	190_E	1.521	0.53
91_T	96_P	1.513	0.53
144_V	196_I	1.506	0.53
119_V	146_L	1.500	0.52
44_I	151_K	1.480	0.51
49_P	195_I	1.453	0.50
77_I	107_I	1.442	0.49
8_F	184_I	1.435	0.49
48_G	71_Y	1.419	0.48
91_T	95_N	1.405	0.48
162_F	187_K	1.405	0.48
92_F	95_N	1.360	0.45
62_I	153_S	1.359	0.45
48_G	160_M	1.342	0.44
44_I	190_E	1.340	0.44
37_I	63_I	1.318	0.43
23_L	62_I	1.313	0.43
39_G	76_G	1.286	0.42
20_L	121_P	1.271	0.41
66_D	82_I	1.263	0.40
20_L	100_V	1.246	0.40
45_V	67_G	1.230	0.39
43_A	59_E	1.227	0.39
105_D	199_V	1.210	0.38
42_I	76_G	1.181	0.37
63_I	83_V	1.181	0.37
4_S	112_K	1.174	0.36
72_L	198_Q	1.168	0.36
47_A	168_G	1.164	0.36
82_I	98_Y	1.163	0.36
79_P	88_G	1.154	0.35
160_M	191_I	1.142	0.35
32_E	58_K	1.137	0.35
21_N	130_R	1.115	0.34
144_V	155_I	1.102	0.33
66_D	87_D	1.102	0.33
47_A	67_G	1.101	0.33
69_A	96_P	1.099	0.33
29_D	32_E	1.092	0.32
14_Y	126_M	1.083	0.32
71_Y	163_Q	1.072	0.32
82_I	87_D	1.072	0.32
195_I	199_V	1.062	0.31
23_L	114_K	1.056	0.31
26_K	32_E	1.053	0.31
67_G	91_T	1.048	0.31
46_G	162_F	1.043	0.30
4_S	90_Q	1.036	0.30
3_R	6_F	1.030	0.30
63_I	79_P	1.028	0.30
64_A	110_L	1.027	0.30
8_F	14_Y	1.021	0.29
51_L	76_G	1.007	0.29
37_I	150_M	1.002	0.29
80_D	147_A	0.993	0.28
20_L	48_G	0.988	0.28
81_I	121_P	0.970	0.27
47_A	138_T	0.967	0.27
96_P	109_L	0.941	0.26
144_V	199_V	0.915	0.25
17_A	99_V	0.907	0.25
4_S	109_L	0.896	0.24
156_R	163_Q	0.890	0.24
58_K	83_V	0.888	0.24
63_I	147_A	0.886	0.24
43_A	158_Y	0.871	0.24
10_E	125_V	0.870	0.24
50_Q	163_Q	0.869	0.23
63_I	134_Y	0.867	0.23
84_T	100_V	0.866	0.23
157_L	160_M	0.865	0.23
20_L	119_V	0.852	0.23
95_N	114_K	0.851	0.23
5_W	196_I	0.849	0.23
66_D	160_M	0.843	0.23
73_V	116_M	0.841	0.22
22_Y	111_H	0.836	0.22
88_G	157_L	0.836	0.22
49_P	145_V	0.831	0.22
9_K	12_D	0.830	0.22
99_V	121_P	0.824	0.22
2_I	46_G	0.822	0.22
74_D	116_M	0.818	0.22
44_I	117_D	0.814	0.22
79_P	134_Y	0.812	0.21
101_L	159_A	0.809	0.21
82_I	92_F	0.806	0.21
64_A	76_G	0.805	0.21
49_P	68_A	0.800	0.21
128_F	131_L	0.799	0.21
182_S	191_I	0.798	0.21
60_D	143_A	0.797	0.21
95_N	98_Y	0.788	0.21
44_I	73_V	0.784	0.21
32_E	35_E	0.782	0.20
102_A	136_G	0.779	0.20
21_N	160_M	0.778	0.20
32_E	118_K	0.773	0.20
110_L	186_R	0.773	0.20
152_A	162_F	0.772	0.20
110_L	147_A	0.765	0.20
69_A	73_V	0.764	0.20
24_I	134_Y	0.756	0.20
39_G	42_I	0.752	0.19
52_D	94_K	0.745	0.19
148_K	191_I	0.744	0.19
69_A	91_T	0.744	0.19
19_I	71_Y	0.743	0.19
26_K	110_L	0.739	0.19
51_L	86_L	0.733	0.19
13_D	133_L	0.731	0.19
131_L	134_Y	0.730	0.19
6_F	189_L	0.730	0.19
17_A	79_P	0.726	0.19
113_V	119_V	0.720	0.18
40_R	150_M	0.718	0.18
42_I	147_A	0.715	0.18
13_D	136_G	0.714	0.18
144_V	160_M	0.714	0.18
148_K	195_I	0.713	0.18
8_F	115_E	0.711	0.18
67_G	87_D	0.709	0.18
122_N	132_R	0.707	0.18
30_E	37_I	0.707	0.18
155_I	160_M	0.705	0.18
61_V	115_E	0.704	0.18
82_I	96_P	0.704	0.18
65_A	102_A	0.688	0.18
98_Y	125_V	0.683	0.17
100_V	104_G	0.681	0.17
47_A	68_A	0.680	0.17
2_I	162_F	0.678	0.17
48_G	100_V	0.676	0.17
116_M	158_Y	0.671	0.17
133_L	145_V	0.669	0.17
168_G	191_I	0.668	0.17
65_A	136_G	0.666	0.17
51_L	72_L	0.665	0.17
63_I	143_A	0.662	0.17
108_N	162_F	0.656	0.17
5_W	8_F	0.655	0.17
8_F	33_L	0.655	0.17
2_I	133_L	0.653	0.17
65_A	157_L	0.653	0.17
9_K	98_Y	0.651	0.16
76_G	147_A	0.651	0.16
20_L	87_D	0.650	0.16
75_I	163_Q	0.649	0.16
2_I	95_N	0.644	0.16
30_E	78_V	0.644	0.16
70_N	160_M	0.636	0.16
62_I	147_A	0.630	0.16
16_S	127_P	0.629	0.16
93_P	149_Y	0.628	0.16
90_Q	94_K	0.625	0.16
4_S	120_I	0.624	0.16
156_R	198_Q	0.620	0.16
74_D	125_V	0.618	0.16
7_G	18_S	0.616	0.16
122_N	126_M	0.612	0.15
3_R	122_N	0.611	0.15
42_I	131_L	0.608	0.15
101_L	116_M	0.608	0.15
63_I	190_E	0.600	0.15
38_K	120_I	0.595	0.15
62_I	76_G	0.591	0.15
127_P	131_L	0.586	0.15
133_L	136_G	0.582	0.15
8_F	196_I	0.582	0.15
89_L	115_E	0.579	0.15
40_R	57_L	0.573	0.14
154_K	167_V	0.573	0.14
191_I	194_M	0.571	0.14
20_L	24_I	0.570	0.14
40_R	63_I	0.568	0.14
160_M	168_G	0.568	0.14
43_A	47_A	0.567	0.14
10_E	123_S	0.566	0.14
113_V	149_Y	0.565	0.14
26_K	96_P	0.562	0.14
184_I	189_L	0.560	0.14
97_I	120_I	0.560	0.14
65_A	133_L	0.559	0.14
18_S	155_I	0.557	0.14
18_S	154_K	0.555	0.14
44_I	184_I	0.554	0.14
90_Q	166_I	0.553	0.14
75_I	191_I	0.551	0.14
84_T	126_M	0.550	0.14
98_Y	155_I	0.549	0.14
29_D	80_D	0.549	0.14
6_F	146_L	0.548	0.14
163_Q	198_Q	0.548	0.14
130_R	150_M	0.548	0.14
22_Y	33_L	0.546	0.14
20_L	88_G	0.546	0.14
19_I	77_I	0.545	0.14
49_P	86_L	0.544	0.14
18_S	128_F	0.540	0.14
82_I	167_V	0.538	0.14
38_K	107_I	0.538	0.14
40_R	115_E	0.534	0.13
48_G	81_I	0.534	0.13
167_V	192_A	0.531	0.13
64_A	87_D	0.531	0.13
45_V	69_A	0.530	0.13
16_S	26_K	0.527	0.13
2_I	23_L	0.524	0.13
138_T	143_A	0.524	0.13
3_R	110_L	0.522	0.13
14_Y	29_D	0.519	0.13
49_P	162_F	0.519	0.13
9_K	40_R	0.518	0.13
67_G	148_K	0.517	0.13
48_G	163_Q	0.516	0.13
145_V	199_V	0.514	0.13
23_L	149_Y	0.513	0.13
56_K	62_I	0.513	0.13
23_L	96_P	0.512	0.13
153_S	156_R	0.510	0.13
67_G	96_P	0.508	0.13
130_R	190_E	0.507	0.13
70_N	128_F	0.504	0.13
88_G	136_G	0.504	0.13
129_G	184_I	0.501	0.13
133_L	159_A	0.501	0.13
85_D	188_K	0.500	0.13
139_D	188_K	0.500	0.13
85_D	185_K	0.500	0.13
85_D	142_R	0.500	0.13
139_D	142_R	0.500	0.13
85_D	106_N	0.500	0.13
85_D	140_G	0.500	0.13
85_D	103_H	0.500	0.13
85_D	139_D	0.500	0.13
185_K	188_K	0.500	0.13
103_H	185_K	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1ro7A	3	0.7549	99.8	0.775	Contact Map
2p2vA	3	0.799	99.7	0.781	Contact Map
2wqqA	1	0.7059	99.6	0.798	Contact Map
3melA	2	0.6471	99.5	0.82	Contact Map
3l8mA	5	0.6029	99.4	0.821	Contact Map
3ihkA	3	0.6324	99.4	0.823	Contact Map
3lm8A	2	0.6225	99.3	0.832	Contact Map
3cq9A	2	0.6373	99.3	0.833	Contact Map
2omkA	2	0.6961	99.3	0.835	Contact Map
3k94A	2	0.6127	99.2	0.841	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0078 seconds.