Q97W30 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97W30 - Uncharacterized protein

UniProt:	Q97W30	Sequences: MKVRVGIEGITMDSAHYTLSSYADSQIHGHTYIVNVEVEGEVNEKSGFVVDFNLLKKIIKETIQEWDHKLIIPKVDLDKSRFEGPFRVDYKVIDAPFPTAEYIGIEIAKDIYLKLNKKYRILLKIYEGKDSYAIIEYP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	138 (114)
Sequences:	2510 (1530)
Seq/√Len:	143.3

ECOLI - QUED
BACSU - QUED
HALSA - Q9HHN6 Q9HQS7
SULSO - Q97W30

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
13_D	31_T	3.492	1.00
40_G	49_V	3.211	1.00
124_K	134_I	3.076	1.00
122_L	134_I	2.857	1.00
39_E	121_I	2.550	1.00
35_N	124_K	2.546	1.00
65_E	110_D	2.485	1.00
105_I	109_K	2.432	1.00
66_W	106_E	2.307	1.00
17_Y	70_L	2.165	1.00
34_V	125_I	2.161	1.00
27_I	70_L	2.154	1.00
108_A	135_I	2.040	1.00
61_E	114_K	1.921	1.00
36_V	59_I	1.905	1.00
12_M	16_H	1.886	1.00
60_K	64_Q	1.862	1.00
15_A	70_L	1.840	1.00
9_G	35_N	1.825	1.00
66_W	107_I	1.793	1.00
38_V	50_V	1.779	1.00
9_G	33_I	1.771	1.00
38_V	55_L	1.754	1.00
104_G	123_L	1.715	1.00
37_E	122_L	1.707	1.00
35_N	126_Y	1.699	1.00
36_V	111_I	1.620	1.00
105_I	135_I	1.598	1.00
23_A	53_N	1.590	1.00
102_Y	105_I	1.564	1.00
7_I	37_E	1.511	1.00
32_Y	100_A	1.434	1.00
31_T	129_K	1.377	1.00
106_E	110_D	1.364	1.00
26_Q	69_K	1.337	1.00
91_K	94_D	1.296	1.00
12_M	34_V	1.276	1.00
47_G	102_Y	1.266	1.00
124_K	132_Y	1.223	1.00
33_I	129_K	1.185	1.00
37_E	124_K	1.151	0.99
61_E	64_Q	1.141	0.99
51_D	54_L	1.126	0.99
33_I	126_Y	1.066	0.99
11_T	130_D	1.041	0.99
37_E	121_I	1.041	0.99
100_A	103_I	1.029	0.99
54_L	57_K	1.023	0.99
53_N	56_K	1.023	0.99
48_F	99_T	1.021	0.99
125_I	133_A	1.020	0.99
25_S	99_T	1.004	0.99
104_G	133_A	1.003	0.99
15_A	27_I	0.998	0.99
11_T	31_T	0.988	0.98
126_Y	132_Y	0.987	0.98
12_M	15_A	0.985	0.98
6_G	16_H	0.980	0.98
40_G	43_N	0.979	0.98
50_V	54_L	0.976	0.98
110_D	113_L	0.962	0.98
107_I	111_I	0.961	0.98
6_G	12_M	0.941	0.98
6_G	23_A	0.937	0.98
57_K	61_E	0.936	0.98
59_I	63_I	0.930	0.98
109_K	112_Y	0.895	0.97
39_E	119_Y	0.893	0.97
43_N	46_S	0.890	0.97
14_S	17_Y	0.884	0.97
104_G	125_I	0.869	0.96
112_Y	116_N	0.867	0.96
10_I	18_T	0.833	0.95
7_I	132_Y	0.825	0.95
90_Y	94_D	0.821	0.95
20_S	46_S	0.816	0.95
31_T	126_Y	0.816	0.95
52_F	131_S	0.815	0.95
66_W	110_D	0.812	0.95
66_W	103_I	0.811	0.95
21_S	25_S	0.810	0.95
71_I	91_K	0.807	0.95
14_S	71_I	0.803	0.95
8_E	12_M	0.799	0.94
96_P	106_E	0.781	0.94
24_D	52_F	0.776	0.93
42_V	105_I	0.765	0.93
8_E	130_D	0.765	0.93
97_F	100_A	0.754	0.92
108_A	112_Y	0.753	0.92
7_I	124_K	0.749	0.92
92_V	95_A	0.738	0.92
100_A	133_A	0.733	0.91
52_F	56_K	0.732	0.91
96_P	102_Y	0.724	0.91
65_E	92_V	0.721	0.91
10_I	59_I	0.715	0.90
15_A	20_S	0.713	0.90
14_S	32_Y	0.702	0.90
107_I	123_L	0.699	0.89
34_V	59_I	0.684	0.88
50_V	55_L	0.684	0.88
16_H	24_D	0.678	0.88
66_W	92_V	0.677	0.88
72_I	98_P	0.672	0.87
114_K	117_K	0.662	0.87
24_D	68_H	0.651	0.86
6_G	15_A	0.646	0.85
108_A	123_L	0.645	0.85
55_L	115_L	0.645	0.85
100_A	131_S	0.643	0.85
100_A	129_K	0.643	0.85
103_I	107_I	0.642	0.85
108_A	120_R	0.642	0.85
62_T	65_E	0.638	0.85
105_I	108_A	0.634	0.84
8_E	131_S	0.633	0.84
56_K	60_K	0.632	0.84
113_L	117_K	0.631	0.84
58_I	115_L	0.627	0.84
100_A	127_E	0.620	0.83
32_Y	131_S	0.616	0.82
72_I	91_K	0.615	0.82
9_G	14_S	0.612	0.82
6_G	9_G	0.612	0.82
58_I	114_K	0.609	0.82
106_E	109_K	0.600	0.81
28_H	127_E	0.597	0.80
50_V	58_I	0.595	0.80
13_D	129_K	0.592	0.80
10_I	63_I	0.592	0.80
61_E	110_D	0.590	0.80
11_T	14_S	0.589	0.80
62_T	107_I	0.588	0.79
111_I	120_R	0.583	0.79
97_F	102_Y	0.578	0.78
107_I	125_I	0.576	0.78
20_S	25_S	0.575	0.78
92_V	96_P	0.575	0.78
8_E	16_H	0.575	0.78
24_D	127_E	0.571	0.77
110_D	118_K	0.570	0.77
7_I	134_I	0.565	0.77
113_L	120_R	0.561	0.76
16_H	23_A	0.553	0.75
109_K	113_L	0.551	0.75
112_Y	117_K	0.549	0.75
17_Y	25_S	0.549	0.75
48_F	69_K	0.539	0.73
13_D	16_H	0.539	0.73
11_T	129_K	0.535	0.73
116_N	119_Y	0.534	0.73
42_V	46_S	0.531	0.72
71_I	94_D	0.528	0.72
108_A	128_G	0.527	0.72
57_K	60_K	0.526	0.72
54_L	118_K	0.525	0.71
43_N	47_G	0.521	0.71
92_V	106_E	0.521	0.71
42_V	47_G	0.516	0.70
93_I	98_P	0.515	0.70
32_Y	128_G	0.512	0.70
15_A	128_G	0.511	0.69
36_V	123_L	0.509	0.69
98_P	106_E	0.508	0.69
90_Y	93_I	0.507	0.69
45_K	58_I	0.507	0.69
69_K	73_P	0.506	0.69
31_T	128_G	0.505	0.69
17_Y	27_I	0.503	0.68
43_N	49_V	0.500	0.68

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3d7jA	4	0.8841	100	0.22	Contact Map
1b66A	4	0.8913	100	0.231	Contact Map
1y13A	5	0.9928	100	0.233	Contact Map
2obaA	4	0.8551	100	0.234	Contact Map
2g64A	4	0.8913	100	0.235	Contact Map
3jygA	4	0.971	100	0.237	Contact Map
3lx3A	4	0.9928	100	0.238	Contact Map
4ntkA	4	0.8551	100	0.248	Contact Map
2dj6A	3	0.8261	100	0.269	Contact Map
1sqlA	5	0.7536	12.3	0.942	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.