Q97W22 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97W22 - Purine phosphoribosyltransferase (GpT-2)

UniProt:	Q97W22	Sequences: MVEYHIPSWDEIEDAVFSIGEALVKSNYIPDVLIAVLTGGIIPAKLLSDLLDLKVIRYIDIKFYRSVGKTESKPVIRSVYTDSLEGKKVLVVDDVADTGETLEAVSNVITMFNPAKVMTAALYLKPWSKRIPDFYYKQIDKWIIFPWDKWDVVRENSNVPVDKKERFLNLYNQLLKIRK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	179 (157)
Sequences:	4192 (2503)
Seq/√Len:	199.8

ECOLI - HPRT XGPT
BACSU - HPRT
HALSA - Q9HS98
SULSO - Q97W22 Q97W95

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
26_S	134_F	3.596	1.00
118_M	133_D	3.534	1.00
106_S	110_T	3.015	1.00
88_K	116_K	2.877	1.00
35_A	44_A	2.824	1.00
15_A	18_S	2.645	1.00
17_F	50_L	2.644	1.00
8_S	11_E	2.638	1.00
88_K	115_A	2.601	1.00
85_E	113_N	2.306	1.00
103_E	107_N	2.303	1.00
15_A	137_K	2.300	1.00
33_L	48_S	2.275	1.00
30_P	88_K	2.126	1.00
24_V	52_D	2.098	1.00
36_V	105_V	2.012	1.00
24_V	53_L	2.010	1.00
9_W	13_E	1.857	1.00
114_P	117_V	1.781	1.00
26_S	118_M	1.776	1.00
139_I	142_W	1.763	1.00
124_L	129_K	1.749	1.00
20_G	24_V	1.727	1.00
33_L	90_L	1.726	1.00
55_V	87_K	1.723	1.00
96_A	132_P	1.720	1.00
106_S	119_T	1.719	1.00
66_S	150_W	1.679	1.00
46_L	49_D	1.652	1.00
25_K	28_Y	1.646	1.00
124_L	138_Q	1.645	1.00
46_L	145_F	1.580	1.00
19_I	136_Y	1.546	1.00
123_Y	142_W	1.542	1.00
23_L	47_L	1.526	1.00
13_E	50_L	1.522	1.00
30_P	115_A	1.514	1.00
36_V	59_I	1.495	1.00
42_I	48_S	1.424	1.00
33_L	51_L	1.423	1.00
108_V	112_F	1.414	1.00
126_P	138_Q	1.414	1.00
41_I	45_K	1.396	1.00
123_Y	159_V	1.380	1.00
45_K	49_D	1.380	1.00
35_A	40_G	1.374	1.00
41_I	56_I	1.369	1.00
9_W	157_S	1.356	1.00
27_N	116_K	1.348	1.00
10_D	14_D	1.330	1.00
11_E	14_D	1.322	1.00
78_S	81_T	1.313	1.00
79_V	112_F	1.311	1.00
15_A	22_A	1.290	1.00
23_L	51_L	1.283	1.00
18_S	137_K	1.230	1.00
17_F	21_E	1.195	1.00
20_G	51_L	1.181	1.00
21_E	25_K	1.178	1.00
27_N	118_M	1.172	1.00
104_A	107_N	1.168	1.00
22_A	26_S	1.168	1.00
47_L	92_V	1.159	1.00
127_W	141_K	1.129	1.00
22_A	25_K	1.125	1.00
132_P	135_Y	1.117	1.00
42_I	45_K	1.112	1.00
24_V	51_L	1.106	1.00
86_G	115_A	1.105	1.00
123_Y	139_I	1.072	1.00
9_W	50_L	1.056	1.00
16_V	43_P	1.053	1.00
41_I	58_Y	1.038	1.00
118_M	134_F	1.026	1.00
93_D	121_A	1.023	1.00
107_N	110_T	1.015	1.00
19_I	120_A	1.001	1.00
142_W	147_W	0.994	1.00
7_P	139_I	0.985	1.00
42_I	49_D	0.982	1.00
57_R	78_S	0.980	1.00
13_E	46_L	0.979	1.00
61_I	105_V	0.977	1.00
18_S	22_A	0.970	0.99
21_E	24_V	0.957	0.99
124_L	135_Y	0.952	0.99
14_D	18_S	0.951	0.99
32_V	55_V	0.950	0.99
102_L	119_T	0.927	0.99
32_V	82_D	0.924	0.99
80_Y	84_L	0.920	0.99
91_V	106_S	0.919	0.99
23_L	120_A	0.917	0.99
34_I	80_Y	0.917	0.99
43_P	120_A	0.917	0.99
71_E	74_P	0.916	0.99
107_N	111_M	0.914	0.99
38_T	151_D	0.903	0.99
91_V	109_I	0.902	0.99
128_S	141_K	0.895	0.99
127_W	140_D	0.893	0.99
108_V	111_M	0.892	0.99
31_D	87_K	0.879	0.99
48_S	56_I	0.872	0.99
84_L	114_P	0.866	0.99
41_I	48_S	0.866	0.99
23_L	90_L	0.865	0.99
119_T	130_R	0.858	0.99
124_L	128_S	0.846	0.99
96_A	121_A	0.828	0.98
60_D	78_S	0.825	0.98
124_L	132_P	0.819	0.98
121_A	135_Y	0.818	0.98
106_S	130_R	0.815	0.98
93_D	96_A	0.815	0.98
93_D	119_T	0.815	0.98
32_V	87_K	0.814	0.98
37_L	41_I	0.802	0.98
120_A	134_F	0.802	0.98
60_D	77_R	0.798	0.98
55_V	152_V	0.795	0.98
44_A	56_I	0.792	0.98
33_L	92_V	0.789	0.98
20_G	50_L	0.779	0.98
64_Y	97_D	0.778	0.98
27_N	90_L	0.778	0.98
59_I	76_I	0.775	0.97
156_N	160_P	0.775	0.97
5_H	160_P	0.774	0.97
13_E	49_D	0.774	0.97
15_A	136_Y	0.767	0.97
64_Y	125_K	0.752	0.97
97_D	125_K	0.752	0.97
67_V	70_T	0.752	0.97
37_L	58_Y	0.739	0.97
16_V	46_L	0.738	0.97
61_I	77_R	0.737	0.97
59_I	105_V	0.733	0.96
32_V	89_V	0.731	0.96
22_A	134_F	0.722	0.96
16_V	47_L	0.710	0.96
100_E	103_E	0.705	0.96
104_A	108_V	0.703	0.96
11_E	15_A	0.701	0.95
36_V	104_A	0.698	0.95
16_V	50_L	0.697	0.95
36_V	40_G	0.697	0.95
12_I	122_L	0.696	0.95
91_V	119_T	0.691	0.95
9_W	158_N	0.688	0.95
20_G	47_L	0.671	0.94
7_P	137_K	0.665	0.94
50_L	157_S	0.663	0.94
61_I	101_T	0.656	0.94
5_H	8_S	0.656	0.94
33_L	44_A	0.652	0.93
84_L	89_V	0.644	0.93
27_N	30_P	0.644	0.93
110_T	117_V	0.639	0.93
55_V	82_D	0.638	0.93
76_I	108_V	0.638	0.93
31_D	54_K	0.637	0.93
109_I	114_P	0.636	0.93
89_V	117_V	0.636	0.93
121_A	124_L	0.630	0.92
153_V	160_P	0.629	0.92
84_L	117_V	0.626	0.92
16_V	122_L	0.624	0.92
18_S	21_E	0.619	0.91
84_L	109_I	0.617	0.91
13_E	17_F	0.616	0.91
63_F	97_D	0.612	0.91
143_I	153_V	0.612	0.91
32_V	84_L	0.607	0.91
122_L	159_V	0.606	0.91
27_N	88_K	0.594	0.90
34_I	109_I	0.594	0.90
61_I	74_P	0.593	0.90
144_I	148_D	0.592	0.90
67_V	150_W	0.591	0.90
65_R	68_G	0.590	0.89
76_I	104_A	0.590	0.89
75_V	81_T	0.578	0.88
63_F	125_K	0.576	0.88
66_S	69_K	0.576	0.88
23_L	134_F	0.576	0.88
28_Y	31_D	0.575	0.88
44_A	92_V	0.575	0.88
65_R	71_E	0.574	0.88
122_L	137_K	0.570	0.88
38_T	60_D	0.570	0.88
76_I	79_V	0.568	0.88
119_T	133_D	0.567	0.88
47_L	51_L	0.561	0.87
152_V	155_E	0.561	0.87
73_K	104_A	0.557	0.87
21_E	52_D	0.557	0.87
101_T	105_V	0.556	0.86
103_E	110_T	0.556	0.86
34_I	57_R	0.553	0.86
6_I	142_W	0.550	0.86
70_T	98_T	0.550	0.86
26_S	116_K	0.549	0.86
90_L	134_F	0.549	0.86
65_R	150_W	0.543	0.85
67_V	71_E	0.542	0.85
63_F	98_T	0.541	0.85
96_A	128_S	0.537	0.85
66_S	151_D	0.534	0.84
20_G	23_L	0.534	0.84
144_I	154_R	0.532	0.84
46_L	50_L	0.530	0.84
106_S	117_V	0.529	0.84
31_D	152_V	0.527	0.83
149_K	153_V	0.527	0.83
43_P	92_V	0.525	0.83
70_T	74_P	0.525	0.83
31_D	88_K	0.522	0.83
7_P	11_E	0.521	0.83
70_T	100_E	0.519	0.83
39_G	97_D	0.519	0.83
95_V	139_I	0.519	0.83
40_G	45_K	0.518	0.82
106_S	133_D	0.516	0.82
127_W	138_Q	0.516	0.82
34_I	84_L	0.516	0.82
106_S	131_I	0.514	0.82
40_G	60_D	0.513	0.82
24_V	54_K	0.512	0.82
39_G	94_D	0.511	0.82
42_I	46_L	0.511	0.82
128_S	138_Q	0.510	0.81
31_D	55_V	0.506	0.81
57_R	82_D	0.504	0.81
91_V	155_E	0.504	0.81
96_A	102_L	0.500	0.80

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
5bqpA	3	0.9553	100	0.289	Contact Map
3ozfA	4	0.9609	100	0.381	Contact Map
1tc1A	2	0.933	100	0.39	Contact Map
1fsgA	4	0.9553	100	0.393	Contact Map
2jbhA	4	0.9441	100	0.393	Contact Map
4raoA	4	0.9162	100	0.395	Contact Map
4trbA	2	0.9944	100	0.399	Contact Map
1pzmA	2	0.8603	100	0.4	Contact Map
4rqaA	3	0.905	100	0.4	Contact Map
4qyiA	3	0.9106	100	0.4	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.