Q97W20 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97W20 - Lactoylglutathione lyase (Glyoxalase I), putative

UniProt:	Q97W20	Sequences: MQIENLDHIGIVVGNLDEAIKFYQNTFGMKLVHYELIPERGIKVAFLVSNEKNETSIELLEPIDHNDMSNTVAKFLKNRGQGLHHLAIKVSDINRALEELTAKGLQLVDTSPRKGARGHLVAFLHPKSVMGVLLELVQAKEL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	142 (129)
Sequences:	5211 (2634)
Seq/√Len:	231.9

ECOLI - LGUL YAER
BACSU - YQJC YWKD YWBC YURT
HALSA - Q9HRZ3
SULSO - Q97W20

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
21_K	25_N	4.295	1.00
98_E	102_A	3.417	1.00
97_L	107_L	3.292	1.00
99_E	103_K	3.284	1.00
106_Q	127_K	3.192	1.00
92_D	95_R	3.119	1.00
15_N	18_E	2.401	1.00
101_T	110_T	2.395	1.00
100_L	105_L	2.196	1.00
5_N	89_K	2.088	1.00
4_E	91_S	1.985	1.00
74_K	77_K	1.957	1.00
4_E	89_K	1.902	1.00
97_L	101_T	1.892	1.00
85_H	135_E	1.766	1.00
51_E	56_S	1.734	1.00
36_L	43_K	1.703	1.00
14_G	81_Q	1.694	1.00
73_A	77_K	1.649	1.00
95_R	99_E	1.645	1.00
31_L	47_L	1.602	1.00
94_N	98_E	1.593	1.00
64_D	69_S	1.561	1.00
32_V	56_S	1.557	1.00
100_L	136_L	1.548	1.00
41_G	64_D	1.448	1.00
127_K	133_L	1.415	1.00
115_G	120_L	1.413	1.00
70_N	73_A	1.384	1.00
6_L	86_L	1.361	1.00
24_Q	31_L	1.349	1.00
96_A	100_L	1.330	1.00
101_T	107_L	1.322	1.00
18_E	21_K	1.320	1.00
21_K	24_Q	1.289	1.00
31_L	34_Y	1.288	1.00
12_V	72_V	1.270	1.00
99_E	102_A	1.249	1.00
62_P	76_L	1.222	1.00
49_S	88_I	1.215	1.00
87_A	137_V	1.215	1.00
94_N	120_L	1.196	1.00
34_Y	43_K	1.194	1.00
83_L	86_L	1.189	1.00
46_F	58_E	1.181	1.00
8_H	87_A	1.173	1.00
20_I	24_Q	1.145	1.00
62_P	73_A	1.143	1.00
108_V	127_K	1.117	1.00
90_V	96_A	1.112	1.00
109_D	112_P	1.108	1.00
10_G	60_L	1.107	1.00
13_V	59_L	1.105	1.00
62_P	70_N	1.105	1.00
96_A	99_E	1.100	1.00
32_V	48_V	1.096	1.00
65_H	69_S	1.093	1.00
17_D	34_Y	1.090	1.00
94_N	111_S	1.082	1.00
100_L	124_L	1.077	1.00
111_S	114_K	1.069	1.00
22_F	26_T	1.068	1.00
88_I	134_L	1.055	1.00
17_D	21_K	1.054	1.00
46_F	60_L	1.051	1.00
25_N	103_K	1.045	1.00
95_R	98_E	1.038	1.00
93_I	138_Q	1.037	1.00
14_G	76_L	1.019	1.00
12_V	82_G	1.010	1.00
31_L	45_A	1.002	1.00
6_L	55_T	0.993	1.00
19_A	23_Y	0.990	1.00
108_V	133_L	0.981	1.00
37_I	40_R	0.964	1.00
7_D	89_K	0.953	1.00
86_L	134_L	0.952	1.00
32_V	51_E	0.927	1.00
13_V	16_L	0.927	1.00
20_I	47_L	0.920	1.00
94_N	122_A	0.897	0.99
123_F	135_E	0.896	0.99
93_I	136_L	0.894	0.99
80_G	87_A	0.889	0.99
35_E	41_G	0.889	0.99
16_L	20_I	0.881	0.99
20_I	31_L	0.878	0.99
19_A	22_F	0.875	0.99
127_K	131_G	0.870	0.99
41_G	63_I	0.870	0.99
37_I	42_I	0.865	0.99
97_L	122_A	0.862	0.99
12_V	84_H	0.851	0.99
5_N	54_E	0.848	0.99
116_A	119_H	0.844	0.99
93_I	97_L	0.840	0.99
109_D	113_R	0.829	0.99
44_V	60_L	0.829	0.99
24_Q	30_K	0.818	0.99
124_L	129_V	0.809	0.99
53_N	56_S	0.803	0.99
73_A	76_L	0.801	0.99
119_H	128_S	0.797	0.99
15_N	21_K	0.789	0.99
98_E	101_T	0.787	0.99
9_I	86_L	0.785	0.99
15_N	19_A	0.785	0.99
19_A	59_L	0.782	0.99
7_D	87_A	0.766	0.98
122_A	138_Q	0.765	0.98
29_M	49_S	0.765	0.98
11_I	83_L	0.765	0.98
43_K	61_E	0.744	0.98
15_N	61_E	0.732	0.98
106_Q	128_S	0.716	0.97
11_I	86_L	0.711	0.97
115_G	123_F	0.708	0.97
48_V	54_E	0.700	0.97
75_F	82_G	0.699	0.97
100_L	107_L	0.698	0.97
87_A	134_L	0.693	0.97
35_E	44_V	0.692	0.97
75_F	80_G	0.683	0.97
12_V	60_L	0.683	0.97
42_I	46_F	0.681	0.97
42_I	60_L	0.680	0.97
93_I	96_A	0.678	0.96
93_I	111_S	0.678	0.96
69_S	72_V	0.672	0.96
17_D	47_L	0.669	0.96
128_S	132_V	0.664	0.96
119_H	123_F	0.663	0.96
129_V	132_V	0.657	0.96
11_I	57_I	0.654	0.96
128_S	131_G	0.650	0.95
120_L	123_F	0.647	0.95
119_H	122_A	0.645	0.95
16_L	45_A	0.645	0.95
13_V	57_I	0.643	0.95
41_G	45_A	0.640	0.95
46_F	49_S	0.637	0.95
19_A	130_M	0.637	0.95
38_P	63_I	0.636	0.95
14_G	77_K	0.634	0.95
26_T	103_K	0.627	0.95
36_L	63_I	0.627	0.95
75_F	132_V	0.627	0.95
74_K	78_N	0.621	0.94
12_V	76_L	0.615	0.94
113_R	120_L	0.615	0.94
71_T	84_H	0.613	0.94
17_D	45_A	0.609	0.94
43_K	63_I	0.605	0.93
60_L	72_V	0.603	0.93
112_P	123_F	0.600	0.93
48_V	56_S	0.598	0.93
70_N	75_F	0.593	0.93
22_F	27_F	0.586	0.92
29_M	52_K	0.582	0.92
120_L	124_L	0.579	0.92
70_N	77_K	0.576	0.92
21_K	26_T	0.572	0.91
115_G	121_V	0.571	0.91
44_V	58_E	0.571	0.91
16_L	61_E	0.564	0.91
51_E	54_E	0.560	0.91
35_E	60_L	0.557	0.90
52_K	55_T	0.557	0.90
14_G	18_E	0.551	0.90
23_Y	59_L	0.548	0.90
121_V	137_V	0.541	0.89
10_G	84_H	0.539	0.89
41_G	65_H	0.539	0.89
85_H	134_L	0.537	0.89
120_L	138_Q	0.531	0.88
76_L	84_H	0.529	0.88
101_T	112_P	0.527	0.88
13_V	76_L	0.527	0.88
94_N	112_P	0.524	0.87
71_T	75_F	0.524	0.87
7_D	137_V	0.523	0.87
114_K	120_L	0.521	0.87
12_V	62_P	0.519	0.87
56_S	119_H	0.516	0.87
29_M	55_T	0.513	0.86
94_N	113_R	0.512	0.86
72_V	76_L	0.510	0.86
127_K	136_L	0.507	0.86
122_A	128_S	0.506	0.86
21_K	78_N	0.505	0.85
84_H	123_F	0.504	0.85
41_G	44_V	0.500	0.85
93_I	107_L	0.500	0.85
118_G	121_V	0.500	0.85

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3isqA	2	0.9718	99.9	0.356	Contact Map
1sqdA	2	0.9718	99.9	0.369	Contact Map
1sp8A	2	0.9718	99.9	0.374	Contact Map
2r5vA	1	0.9155	99.8	0.404	Contact Map
1t47A	2	0.9718	99.8	0.424	Contact Map
1cjxA	2	0.8803	99.8	0.428	Contact Map
1jc4A	2	0.9718	99.7	0.454	Contact Map
3gm5A	2	0.9085	99.7	0.454	Contact Map
3zgjA	1	0.9366	99.7	0.455	Contact Map
3hdpA	2	0.9155	99.7	0.456	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.