Q97W19 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97W19 - Small heat shock protein hsp20 family

UniProt:	Q97W19	Sequences: MPKREEKDIFDLMDEWIREMEEEFERIEREFMRGFRGKGEGIRQFGPYVYGFRITVGPDGVPKIEEFGNVRKIRGKPMISEEREPLADVIEKGDEIKVVAEVPGVNKEDIKVKVTNGGKKLVITAKSEDRQYYKEIDLPAEVDEKAAKANFKNGVLEITLKKKASSSDSGVDIKVE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	176 (149)
Sequences:	316 (280)
Seq/√Len:	22.9

BACSU - COTP YOCM
HALSA - Q9HSS6 Q9HP50 Q9HHW1
SULSO - Q97W19 Q97VL9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
87_A	100_A	3.183	1.00
121_L	158_I	3.095	1.00
100_A	123_I	2.995	1.00
171_V	175_V	2.584	0.99
107_K	148_K	2.547	0.99
111_K	172_D	2.441	0.98
83_R	101_E	2.441	0.98
50_Y	69_N	2.436	0.98
121_L	147_A	2.407	0.98
164_A	167_S	2.296	0.97
30_E	34_G	2.087	0.95
143_D	146_A	2.059	0.94
91_E	162_K	1.952	0.93
33_R	36_R	1.932	0.92
102_V	132_Y	1.857	0.91
24_F	32_M	1.848	0.90
113_K	172_D	1.845	0.90
96_I	140_A	1.756	0.88
27_I	34_G	1.718	0.87
31_F	34_G	1.683	0.86
110_I	151_F	1.679	0.86
57_G	60_G	1.663	0.85
138_L	148_K	1.660	0.85
25_E	29_R	1.642	0.84
89_V	94_D	1.632	0.84
87_A	134_K	1.612	0.83
57_G	105_V	1.591	0.82
96_I	173_I	1.580	0.82
84_E	134_K	1.563	0.81
106_N	153_N	1.556	0.81
108_E	136_I	1.551	0.81
62_P	66_E	1.542	0.80
144_E	161_K	1.521	0.79
24_F	31_F	1.495	0.78
25_E	28_E	1.492	0.78
170_G	175_V	1.486	0.78
95_E	161_K	1.486	0.78
50_Y	68_G	1.485	0.78
89_V	98_V	1.433	0.75
146_A	161_K	1.409	0.74
136_I	142_V	1.379	0.72
147_A	160_L	1.376	0.72
131_Q	136_I	1.372	0.72
114_V	132_Y	1.362	0.71
143_D	158_I	1.341	0.70
145_K	171_V	1.327	0.69
28_E	31_F	1.324	0.69
30_E	33_R	1.315	0.68
113_K	122_V	1.298	0.67
109_D	127_S	1.293	0.67
121_L	155_V	1.285	0.66
89_V	173_I	1.269	0.65
69_N	84_E	1.263	0.65
34_G	37_G	1.253	0.64
102_V	109_D	1.225	0.63
59_D	62_P	1.199	0.61
99_V	157_E	1.197	0.61
98_V	158_I	1.189	0.60
96_I	157_E	1.184	0.60
49_V	52_F	1.170	0.59
87_A	138_L	1.163	0.59
67_F	175_V	1.157	0.58
115_T	120_K	1.137	0.57
142_V	160_L	1.134	0.57
120_K	135_E	1.134	0.57
110_I	161_K	1.117	0.55
100_A	157_E	1.115	0.55
24_F	27_I	1.101	0.54
28_E	33_R	1.093	0.54
111_K	124_T	1.092	0.54
93_G	97_K	1.087	0.53
122_V	135_E	1.077	0.53
96_I	147_A	1.068	0.52
121_L	141_E	1.065	0.52
138_L	162_K	1.064	0.52
111_K	115_T	1.060	0.51
105_V	110_I	1.054	0.51
49_V	67_F	1.038	0.50
62_P	68_G	1.022	0.49
101_E	127_S	1.015	0.48
95_E	98_V	1.013	0.48
26_R	29_R	0.988	0.46
61_V	83_R	0.982	0.46
65_E	68_G	0.981	0.46
87_A	125_A	0.977	0.46
52_F	68_G	0.964	0.45
91_E	155_V	0.963	0.45
86_L	101_E	0.960	0.45
70_V	132_Y	0.959	0.44
27_I	35_F	0.957	0.44
164_A	168_D	0.947	0.44
68_G	71_R	0.942	0.43
49_V	65_E	0.931	0.43
56_V	60_G	0.929	0.42
92_K	97_K	0.920	0.42
142_V	149_A	0.917	0.42
28_E	112_V	0.917	0.42
88_D	155_V	0.915	0.41
27_I	33_R	0.914	0.41
28_E	35_F	0.904	0.41
73_I	167_S	0.901	0.41
65_E	93_G	0.900	0.40
98_V	124_T	0.900	0.40
168_D	171_V	0.881	0.39
96_I	133_Y	0.864	0.38
91_E	109_D	0.860	0.38
101_E	155_V	0.854	0.37
44_Q	114_V	0.850	0.37
48_Y	59_D	0.849	0.37
24_F	28_E	0.837	0.36
86_L	132_Y	0.836	0.36
98_V	136_I	0.835	0.36
61_V	69_N	0.824	0.36
103_P	156_L	0.823	0.35
87_A	99_V	0.807	0.34
96_I	162_K	0.804	0.34
96_I	100_A	0.800	0.34
27_I	31_F	0.799	0.34
28_E	36_R	0.798	0.34
131_Q	134_K	0.787	0.33
126_K	131_Q	0.784	0.33
61_V	155_V	0.784	0.33
115_T	121_L	0.783	0.33
125_A	139_P	0.783	0.33
51_G	68_G	0.782	0.33
84_E	135_E	0.775	0.32
124_T	145_K	0.774	0.32
86_L	134_K	0.766	0.32
138_L	160_L	0.762	0.32
68_G	84_E	0.761	0.32
141_E	162_K	0.758	0.31
101_E	105_V	0.755	0.31
82_E	158_I	0.754	0.31
149_A	154_G	0.743	0.31
104_G	162_K	0.738	0.30
93_G	124_T	0.738	0.30
51_G	69_N	0.728	0.30
87_A	157_E	0.727	0.30
58_P	66_E	0.724	0.29
59_D	84_E	0.719	0.29
52_F	67_F	0.710	0.29
164_A	169_S	0.709	0.29
120_K	163_K	0.705	0.28
125_A	134_K	0.705	0.28
148_K	160_L	0.702	0.28
109_D	126_K	0.700	0.28
59_D	68_G	0.699	0.28
125_A	130_R	0.695	0.28
80_S	93_G	0.694	0.28
85_P	101_E	0.694	0.28
50_Y	84_E	0.692	0.28
119_K	128_E	0.690	0.28
57_G	61_V	0.685	0.27
145_K	169_S	0.679	0.27
124_T	133_Y	0.674	0.27
63_K	72_K	0.668	0.26
29_R	98_V	0.661	0.26
30_E	36_R	0.659	0.26
25_E	30_E	0.657	0.26
55_T	68_G	0.652	0.25
31_F	112_V	0.651	0.25
120_K	127_S	0.634	0.25
29_R	33_R	0.630	0.24
66_E	71_R	0.626	0.24
31_F	35_F	0.623	0.24
50_Y	57_G	0.619	0.24
51_G	67_F	0.619	0.24
144_E	158_I	0.613	0.23
54_I	132_Y	0.610	0.23
66_E	86_L	0.606	0.23
28_E	32_M	0.604	0.23
90_I	97_K	0.602	0.23
62_P	65_E	0.600	0.23
41_G	123_I	0.599	0.23
24_F	35_F	0.595	0.23
107_K	133_Y	0.593	0.22
158_I	164_A	0.593	0.22
150_N	160_L	0.591	0.22
55_T	63_K	0.590	0.22
40_E	46_G	0.575	0.22
72_K	137_D	0.574	0.22
74_R	155_V	0.573	0.22
47_P	146_A	0.572	0.21
54_I	64_I	0.568	0.21
64_I	67_F	0.566	0.21
30_E	145_K	0.566	0.21
91_E	149_A	0.562	0.21
29_R	32_M	0.561	0.21
105_V	135_E	0.561	0.21
39_G	42_I	0.558	0.21
82_E	88_D	0.558	0.21
133_Y	174_K	0.557	0.21
152_K	175_V	0.555	0.21
99_V	112_V	0.554	0.21
48_Y	132_Y	0.547	0.20
71_R	123_I	0.546	0.20
95_E	111_K	0.544	0.20
58_P	62_P	0.543	0.20
40_E	140_A	0.537	0.20
77_P	141_E	0.536	0.20
28_E	34_G	0.535	0.20
52_F	153_N	0.535	0.20
41_G	112_V	0.531	0.20
85_P	99_V	0.527	0.19
73_I	78_M	0.526	0.19
107_K	116_N	0.526	0.19
75_G	89_V	0.523	0.19
127_S	132_Y	0.523	0.19
42_I	144_E	0.522	0.19
84_E	87_A	0.520	0.19
44_Q	110_I	0.517	0.19
26_R	30_E	0.517	0.19
51_G	58_P	0.515	0.19
149_A	156_L	0.508	0.19
88_D	136_I	0.508	0.19
45_F	53_R	0.507	0.19
56_V	59_D	0.507	0.19
125_A	128_E	0.506	0.19
131_Q	167_S	0.506	0.19
85_P	151_F	0.505	0.19
88_D	154_G	0.505	0.19
67_F	78_M	0.505	0.19
69_N	153_N	0.503	0.18
53_R	61_V	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2bolA	2	0.9205	99.9	0.447	Contact Map
4eldA	4	0.5682	99.9	0.455	Contact Map
1gmeA	6	0.7216	99.9	0.463	Contact Map
3aabA	2	0.5795	99.9	0.475	Contact Map
3w1zA	7	0.7102	99.9	0.479	Contact Map
4jutA	4	0.4545	99.9	0.499	Contact Map
4ydzA	4	0.608	99.9	0.501	Contact Map
3l1eA	2	0.517	99.9	0.503	Contact Map
4ye0A	2	0.5114	99.9	0.507	Contact Map
3glaA	2	0.4773	99.9	0.511	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.