Q97W15 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97W15 - Uncharacterized protein

UniProt:	Q97W15	Sequences: MNIGVIILAAGEGKRFGGDKLLAKIDNTPIIMRTIRIYGDLEKIIIVGKYVNEMLPLLMDQIVIYNPFWNEGISTSLKLGLRFFKDYDAVLVALGDMPFVTKEDVNKIINTFKPNCKAVIPTHKGERGNPVLISKSLFNEIEKLRGDVGARVILNKIKIEELCFIECSEGVLIDIDKKEDLMRLRDFHP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	189 (178)
Sequences:	8296 (6312)
Seq/√Len:	473.1

ECOLI - MOCA MOBA
BACSU - MOBA PUCB
HALSA - Q9HR78
SULSO - Q97W15 Q7LXN3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
28_T	36_R	4.816	1.00
4_G	87_Y	3.074	1.00
21_L	95_G	2.705	1.00
16_F	23_A	2.657	1.00
29_P	32_M	2.655	1.00
5_V	38_Y	2.553	1.00
6_I	80_G	2.550	1.00
43_K	62_I	2.424	1.00
5_V	41_L	2.415	1.00
89_A	112_F	2.264	1.00
101_T	171_V	2.228	1.00
104_D	171_V	2.213	1.00
177_K	180_D	2.143	1.00
4_G	43_K	2.084	1.00
112_F	119_V	2.081	1.00
38_Y	93_A	2.079	1.00
23_A	181_L	1.922	1.00
175_I	184_L	1.870	1.00
28_T	33_R	1.852	1.00
140_E	156_K	1.804	1.00
6_I	90_V	1.767	1.00
94_L	97_M	1.739	1.00
99_F	184_L	1.717	1.00
32_M	36_R	1.713	1.00
118_A	157_I	1.694	1.00
71_E	75_T	1.692	1.00
50_Y	53_E	1.681	1.00
40_D	102_K	1.678	1.00
4_G	84_F	1.671	1.00
28_T	32_M	1.649	1.00
93_A	105_V	1.627	1.00
91_L	105_V	1.623	1.00
82_R	142_E	1.569	1.00
84_F	90_V	1.544	1.00
66_N	75_T	1.523	1.00
12_E	70_N	1.514	1.00
101_T	104_D	1.514	1.00
140_E	157_I	1.491	1.00
149_G	152_V	1.478	1.00
32_M	57_L	1.452	1.00
120_I	127_R	1.447	1.00
51_V	55_L	1.440	1.00
122_T	164_F	1.430	1.00
37_I	102_K	1.383	1.00
102_K	106_N	1.378	1.00
77_L	92_V	1.371	1.00
81_L	142_E	1.365	1.00
173_I	183_R	1.345	1.00
93_A	100_V	1.340	1.00
173_I	184_L	1.333	1.00
90_V	134_S	1.317	1.00
7_I	35_I	1.310	1.00
13_G	18_G	1.296	1.00
180_D	183_R	1.263	1.00
45_I	83_F	1.243	1.00
140_E	143_K	1.235	1.00
116_C	163_C	1.230	1.00
153_I	157_I	1.216	1.00
81_L	90_V	1.212	1.00
25_I	30_I	1.206	1.00
19_D	50_Y	1.193	1.00
30_I	175_I	1.191	1.00
75_T	78_K	1.188	1.00
4_G	45_I	1.180	1.00
140_E	153_I	1.178	1.00
55_L	65_Y	1.174	1.00
29_P	57_L	1.155	1.00
81_L	138_F	1.144	1.00
47_V	80_G	1.121	1.00
25_I	184_L	1.118	1.00
89_A	134_S	1.114	1.00
135_K	138_F	1.112	1.00
68_F	71_E	1.110	1.00
39_G	60_D	1.106	1.00
71_E	148_V	1.099	1.00
45_I	64_I	1.099	1.00
151_R	155_N	1.084	1.00
126_E	130_P	1.077	1.00
137_L	140_E	1.071	1.00
26_D	33_R	1.064	1.00
127_R	164_F	1.062	1.00
24_K	29_P	1.042	1.00
16_F	178_K	1.032	1.00
53_E	56_P	1.031	1.00
24_K	27_N	1.024	1.00
139_N	142_E	1.015	1.00
133_I	136_S	1.012	1.00
163_C	166_E	1.011	1.00
111_T	114_P	1.011	1.00
117_K	134_S	1.007	1.00
134_S	138_F	1.006	1.00
7_I	38_Y	1.003	1.00
7_I	34_T	1.003	1.00
6_I	47_V	0.996	1.00
48_G	51_V	0.996	1.00
122_T	166_E	0.992	1.00
62_I	83_F	0.988	1.00
106_N	110_N	0.985	1.00
108_I	119_V	0.981	1.00
78_K	82_R	0.980	1.00
175_I	181_L	0.979	1.00
182_M	185_R	0.977	1.00
6_I	92_V	0.977	1.00
110_N	114_P	0.976	1.00
77_L	150_A	0.975	1.00
75_T	79_L	0.974	1.00
107_K	110_N	0.971	1.00
29_P	33_R	0.958	1.00
62_I	65_Y	0.955	1.00
18_G	178_K	0.952	1.00
116_C	119_V	0.948	1.00
123_H	128_G	0.936	1.00
181_L	185_R	0.931	1.00
139_N	143_K	0.931	1.00
89_A	113_K	0.930	1.00
78_K	142_E	0.929	1.00
9_A	46_I	0.899	1.00
34_T	37_I	0.893	1.00
39_G	44_I	0.891	1.00
30_I	95_G	0.884	1.00
122_T	125_G	0.883	1.00
117_K	136_S	0.881	1.00
33_R	37_I	0.879	1.00
13_G	21_L	0.876	1.00
107_K	111_T	0.871	1.00
22_L	57_L	0.869	1.00
89_A	132_L	0.859	1.00
144_L	147_D	0.851	1.00
111_T	163_C	0.849	1.00
118_A	154_L	0.848	1.00
64_I	79_L	0.843	1.00
37_I	40_D	0.843	1.00
77_L	94_L	0.842	1.00
144_L	153_I	0.840	1.00
91_L	109_I	0.835	1.00
51_V	65_Y	0.833	1.00
35_I	44_I	0.825	1.00
152_V	155_N	0.825	1.00
143_K	156_K	0.814	1.00
48_G	70_N	0.813	1.00
133_I	141_I	0.813	1.00
32_M	59_M	0.808	1.00
136_S	139_N	0.806	1.00
45_I	62_I	0.801	1.00
109_I	112_F	0.796	1.00
26_D	185_R	0.792	1.00
18_G	21_L	0.791	1.00
84_F	87_Y	0.786	1.00
74_S	144_L	0.784	1.00
61_Q	64_I	0.775	1.00
31_I	58_L	0.764	1.00
112_F	134_S	0.763	1.00
35_I	61_Q	0.762	1.00
167_C	171_V	0.760	1.00
30_I	34_T	0.758	1.00
18_G	23_A	0.757	1.00
23_A	178_K	0.753	1.00
111_T	165_I	0.750	1.00
68_F	75_T	0.748	1.00
48_G	69_W	0.747	1.00
69_W	75_T	0.747	1.00
7_I	31_I	0.740	1.00
112_F	132_L	0.739	1.00
72_G	75_T	0.737	1.00
49_K	69_W	0.733	1.00
137_L	157_I	0.730	1.00
103_E	106_N	0.721	1.00
90_V	138_F	0.718	1.00
35_I	39_G	0.713	1.00
170_G	173_I	0.710	1.00
66_N	79_L	0.709	1.00
108_I	121_P	0.704	1.00
109_I	113_K	0.704	1.00
108_I	132_L	0.704	1.00
179_E	182_M	0.698	1.00
117_K	158_K	0.691	1.00
13_G	19_D	0.683	1.00
179_E	183_R	0.681	1.00
4_G	88_D	0.681	1.00
31_I	35_I	0.677	1.00
167_C	172_L	0.673	1.00
132_L	153_I	0.672	1.00
88_D	135_K	0.671	1.00
55_L	63_V	0.670	1.00
6_I	45_I	0.668	1.00
111_T	119_V	0.666	1.00
48_G	54_M	0.665	1.00
24_K	28_T	0.662	1.00
52_N	55_L	0.659	1.00
147_D	152_V	0.657	1.00
140_E	144_L	0.657	1.00
138_F	142_E	0.657	1.00
13_G	181_L	0.653	1.00
127_R	130_P	0.653	1.00
74_S	78_K	0.652	1.00
34_T	38_Y	0.651	1.00
106_N	109_I	0.651	1.00
34_T	93_A	0.650	1.00
99_F	173_I	0.648	1.00
85_K	88_D	0.648	1.00
178_K	182_M	0.645	1.00
138_F	144_L	0.641	1.00
148_V	152_V	0.639	1.00
70_N	75_T	0.639	1.00
66_N	76_S	0.635	1.00
133_I	137_L	0.633	1.00
6_I	84_F	0.629	1.00
19_D	22_L	0.627	0.99
11_G	15_R	0.626	0.99
117_K	120_I	0.621	0.99
107_K	165_I	0.621	0.99
25_I	185_R	0.618	0.99
24_K	185_R	0.614	0.99
162_L	165_I	0.613	0.99
120_I	154_L	0.613	0.99
91_L	132_L	0.610	0.99
73_I	76_S	0.610	0.99
87_Y	135_K	0.609	0.99
12_E	69_W	0.607	0.99
41_L	44_I	0.606	0.99
4_G	90_V	0.605	0.99
41_L	91_L	0.602	0.99
74_S	141_I	0.595	0.99
43_K	87_Y	0.591	0.99
45_I	84_F	0.589	0.99
60_D	63_V	0.586	0.99
36_R	59_M	0.586	0.99
51_V	66_N	0.586	0.99
141_I	153_I	0.586	0.99
103_E	107_K	0.585	0.99
116_C	134_S	0.585	0.99
16_F	181_L	0.584	0.99
38_Y	41_L	0.582	0.99
162_L	167_C	0.577	0.99
151_R	154_L	0.577	0.99
134_S	137_L	0.574	0.99
97_M	172_L	0.569	0.99
43_K	85_K	0.567	0.99
54_M	57_L	0.564	0.99
21_L	31_I	0.561	0.99
117_K	121_P	0.559	0.99
141_I	144_L	0.557	0.99
5_V	34_T	0.557	0.99
144_L	156_K	0.557	0.99
122_T	127_R	0.555	0.99
123_H	169_E	0.553	0.99
169_E	172_L	0.548	0.99
94_L	129_N	0.547	0.99
150_A	153_I	0.545	0.99
163_C	167_C	0.543	0.99
36_R	39_G	0.541	0.99
97_M	129_N	0.530	0.98
66_N	69_W	0.528	0.98
10_A	73_I	0.528	0.98
104_D	121_P	0.524	0.98
144_L	152_V	0.522	0.98
155_N	158_K	0.521	0.98
94_L	130_P	0.518	0.98
78_K	81_L	0.517	0.98
136_S	140_E	0.513	0.98
135_K	139_N	0.512	0.98
117_K	137_L	0.509	0.98
53_E	57_L	0.505	0.98
50_Y	54_M	0.501	0.98
47_V	64_I	0.501	0.98
39_G	59_M	0.500	0.98
51_V	54_M	0.500	0.98

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3d5nA	2	0.9524	100	0.24	Contact Map
2weeA	1	0.9788	100	0.267	Contact Map
2wawA	1	0.9894	100	0.27	Contact Map
1e5kA	1	0.9365	100	0.318	Contact Map
2e8bA	1	0.8942	100	0.325	Contact Map
3ngwA	2	0.9471	100	0.327	Contact Map
2px7A	2	0.9153	100	0.417	Contact Map
2xwlA	2	0.9735	99.9	0.448	Contact Map
1vpaA	2	0.9683	99.9	0.458	Contact Map
1w55A	4	0.9683	99.9	0.459	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.