Q97W14 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97W14 - Carbon monoxide dehydrogenase, small chain (CutC-1)

UniProt:	Q97W14	Sequences: MIYMKVFEKDQKVKVHLKVNGQDYEVETEPRRLLVHVLRELGFTGVHIGCDTSNCGACTVIMDGRSVKSCTILAVEADGAEITTIEGLAKDGKLHPIQEAFWEKHGLQCGYCTPGMIMEAYWLLKENPNPTEEEIREGISGNLCRCTGYQNIIEAVKLASEKLRMEIPKAH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	171 (149)
Sequences:	6873 (4038)
Seq/√Len:	330.8

ECOLI - XDHD YAGT XDHC
BACSU - XDHE
SULSO - Q97W14 Q97VI6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
104_K	158_L	4.111	1.00
132_E	157_K	3.835	1.00
95_H	121_Y	2.779	1.00
18_K	81_E	2.674	1.00
131_T	134_E	2.533	1.00
45_G	85_I	2.516	1.00
26_V	37_V	2.512	1.00
135_I	157_K	2.501	1.00
63_D	80_A	2.409	1.00
99_E	103_E	2.270	1.00
104_K	154_E	2.250	1.00
16_H	25_E	2.061	1.00
120_A	156_V	2.043	1.00
59_T	66_S	1.972	1.00
35_V	48_I	1.966	1.00
53_S	71_T	1.966	1.00
18_K	23_D	1.951	1.00
32_R	37_V	1.929	1.00
62_M	67_V	1.909	1.00
121_Y	125_K	1.896	1.00
37_V	74_A	1.888	1.00
103_E	158_L	1.857	1.00
43_F	46_V	1.835	1.00
16_H	23_D	1.816	1.00
97_I	117_I	1.798	1.00
62_M	72_I	1.771	1.00
61_I	118_M	1.753	1.00
127_N	134_E	1.721	1.00
136_R	153_I	1.684	1.00
14_K	27_E	1.679	1.00
85_I	117_I	1.654	1.00
48_I	51_D	1.595	1.00
99_E	162_K	1.558	1.00
45_G	86_E	1.495	1.00
73_L	76_E	1.459	1.00
20_N	86_E	1.428	1.00
97_I	121_Y	1.416	1.00
66_S	122_W	1.401	1.00
61_I	122_W	1.366	1.00
20_N	43_F	1.362	1.00
158_L	162_K	1.325	1.00
14_K	25_E	1.317	1.00
59_T	118_M	1.299	1.00
83_T	87_G	1.297	1.00
34_L	60_V	1.281	1.00
122_W	126_E	1.265	1.00
123_L	138_G	1.264	1.00
19_V	41_L	1.252	1.00
139_I	156_V	1.250	1.00
61_I	121_Y	1.247	1.00
116_M	139_I	1.238	1.00
17_L	24_Y	1.236	1.00
28_T	74_A	1.226	1.00
90_K	93_K	1.221	1.00
72_I	77_A	1.204	1.00
132_E	154_E	1.204	1.00
127_N	130_P	1.201	1.00
106_G	155_A	1.197	1.00
67_V	72_I	1.190	1.00
97_I	120_A	1.182	1.00
62_M	82_I	1.181	1.00
130_P	160_S	1.149	1.00
94_L	98_Q	1.143	1.00
62_M	80_A	1.139	1.00
34_L	82_I	1.127	1.00
101_F	113_T	1.126	1.00
37_V	41_L	1.113	1.00
150_Q	154_E	1.111	1.00
19_V	24_Y	1.070	1.00
151_N	154_E	1.056	1.00
97_I	159_A	1.055	1.00
88_L	121_Y	1.048	1.00
15_V	78_D	1.034	1.00
29_E	32_R	1.032	1.00
89_A	94_L	1.025	1.00
119_E	141_G	0.993	1.00
34_L	77_A	0.993	1.00
132_E	136_R	0.992	1.00
62_M	77_A	0.976	1.00
35_V	46_V	0.975	1.00
115_G	142_N	0.971	1.00
95_H	98_Q	0.940	1.00
132_E	153_I	0.926	1.00
33_L	36_H	0.918	1.00
46_V	85_I	0.917	1.00
26_V	41_L	0.914	1.00
124_L	160_S	0.901	1.00
65_R	126_E	0.895	1.00
43_F	86_E	0.895	1.00
63_D	81_E	0.893	1.00
83_T	125_K	0.887	1.00
66_S	119_E	0.879	1.00
93_K	99_E	0.865	1.00
60_V	69_S	0.860	1.00
38_L	60_V	0.857	1.00
19_V	43_F	0.856	1.00
103_E	162_K	0.850	1.00
91_D	94_L	0.842	1.00
101_F	117_I	0.841	1.00
153_I	157_K	0.838	1.00
106_G	113_T	0.833	1.00
97_I	124_L	0.829	1.00
21_G	24_Y	0.825	1.00
77_A	80_A	0.824	1.00
61_I	83_T	0.821	1.00
100_A	158_L	0.820	1.00
21_G	81_E	0.807	1.00
158_L	161_E	0.804	1.00
96_P	159_A	0.799	1.00
89_A	92_G	0.798	1.00
88_L	117_I	0.786	1.00
32_R	40_E	0.785	1.00
89_A	93_K	0.784	1.00
120_A	139_I	0.783	1.00
16_H	78_D	0.781	1.00
116_M	152_I	0.780	1.00
72_I	76_E	0.780	1.00
101_F	120_A	0.778	1.00
133_E	136_R	0.775	1.00
28_T	37_V	0.774	1.00
126_E	138_G	0.772	1.00
123_L	130_P	0.751	0.99
17_L	26_V	0.749	0.99
133_E	137_E	0.741	0.99
89_A	98_Q	0.739	0.99
33_L	48_I	0.727	0.99
130_P	138_G	0.723	0.99
104_K	155_A	0.717	0.99
119_E	138_G	0.717	0.99
100_A	159_A	0.709	0.99
20_N	87_G	0.703	0.99
51_D	54_N	0.698	0.99
32_R	74_A	0.698	0.99
36_H	48_I	0.694	0.99
31_R	75_V	0.692	0.99
123_L	135_I	0.691	0.99
66_S	138_G	0.690	0.99
101_F	106_G	0.690	0.99
116_M	142_N	0.682	0.99
44_T	114_P	0.680	0.99
159_A	162_K	0.680	0.99
134_E	138_G	0.678	0.99
124_L	159_A	0.678	0.99
135_I	153_I	0.677	0.99
47_H	114_P	0.675	0.99
35_V	49_G	0.674	0.99
101_F	116_M	0.673	0.99
17_L	37_V	0.670	0.99
105_H	147_T	0.667	0.99
116_M	148_G	0.666	0.99
105_H	148_G	0.665	0.99
33_L	73_L	0.659	0.99
154_E	158_L	0.659	0.99
15_V	28_T	0.659	0.99
55_C	58_C	0.654	0.99
36_H	40_E	0.651	0.99
61_I	66_S	0.646	0.98
127_N	138_G	0.644	0.98
83_T	121_Y	0.640	0.98
107_L	113_T	0.640	0.98
88_L	118_M	0.635	0.98
24_Y	41_L	0.635	0.98
68_K	72_I	0.633	0.98
94_L	102_W	0.626	0.98
50_C	58_C	0.623	0.98
50_C	55_C	0.621	0.98
119_E	142_N	0.619	0.98
101_F	107_L	0.618	0.98
38_L	41_L	0.615	0.98
92_G	96_P	0.611	0.98
123_L	128_P	0.609	0.98
40_E	44_T	0.605	0.98
105_H	151_N	0.603	0.98
44_T	47_H	0.602	0.98
135_I	156_V	0.597	0.97
72_I	80_A	0.596	0.97
38_L	44_T	0.593	0.97
124_L	130_P	0.592	0.97
64_G	81_E	0.589	0.97
92_G	98_Q	0.588	0.97
64_G	80_A	0.581	0.97
59_T	119_E	0.580	0.97
38_L	46_V	0.578	0.97
123_L	127_N	0.578	0.97
52_T	68_K	0.575	0.97
129_N	161_E	0.575	0.97
102_W	107_L	0.573	0.97
28_T	32_R	0.571	0.97
24_Y	37_V	0.567	0.97
61_I	125_K	0.564	0.96
141_G	149_Y	0.564	0.96
33_L	52_T	0.562	0.96
59_T	142_N	0.562	0.96
92_G	95_H	0.561	0.96
147_T	150_Q	0.558	0.96
74_A	77_A	0.557	0.96
50_C	70_C	0.551	0.96
55_C	70_C	0.546	0.96
30_P	75_V	0.546	0.96
124_L	127_N	0.543	0.96
54_N	68_K	0.541	0.95
15_V	74_A	0.541	0.95
48_I	54_N	0.539	0.95
58_C	70_C	0.538	0.95
32_R	36_H	0.532	0.95
130_P	134_E	0.531	0.95
90_K	94_L	0.526	0.95
47_H	68_K	0.524	0.95
99_E	102_W	0.519	0.94
88_L	95_H	0.518	0.94
87_G	94_L	0.516	0.94
15_V	75_V	0.515	0.94
34_L	72_I	0.515	0.94
124_L	128_P	0.511	0.94
17_L	77_A	0.510	0.94
33_L	51_D	0.509	0.94
17_L	78_D	0.509	0.94
64_G	125_K	0.509	0.94
19_V	38_L	0.508	0.94
48_I	111_Y	0.505	0.94
68_K	119_E	0.503	0.93
107_L	148_G	0.502	0.93
95_H	99_E	0.501	0.93
19_V	82_I	0.500	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3uncA	2	0.8713	100	0.089	Contact Map
3zyvA	3	0.8772	100	0.097	Contact Map
2w3sA	1	0.9064	100	0.131	Contact Map
3nvwA	1	0.883	100	0.136	Contact Map
1dgjA	1	0.9357	100	0.157	Contact Map
4usaA	2	0.9357	100	0.169	Contact Map
1n62A	1	0.9298	100	0.217	Contact Map
3hrdD	1	0.9298	100	0.225	Contact Map
1t3qA	1	0.9415	100	0.269	Contact Map
1rm6C	1	0.9123	100	0.275	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.