GUAAA - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GUAAA - GMP synthase [glutamine-hydrolyzing] subunit A

UniProt:	Q97VZ9	Sequences: MKVGLVYYGGQYNHLILKNVKYLGADIEVIPPHKPVEELKKFDCVIFSGGPYSVSEEIQKMGNSPLYIKELKVPMLGICLGHQLIAYVLGGVVRRALNPEYGLTRINIFDEDTILKGFSQQLNVWESHNDEVVEPPSGFRVLASSANARVQAMANSSNSIFGVQFHPEVKHTERGIEIFKNFLGVCRK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	188 (178)
Sequences:	12955 (7506)
Seq/√Len:	562.6

ECOLI - TRPGD PABA GUAA CARA PUUD
BACSU - PABA GUAA CARA CARX
HALSA - TRPG GUAAA Q9HMK6 CARA
SULSO - GUAAA TRPG CARA Q97X97

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
94_R	133_V	3.161	1.00
86_A	132_V	3.107	1.00
85_I	160_I	2.674	1.00
92_V	133_V	2.390	1.00
142_L	154_A	2.365	1.00
4_G	30_I	2.307	1.00
119_S	174_R	2.277	1.00
140_R	154_A	2.255	1.00
86_A	153_M	2.250	1.00
155_N	158_N	2.242	1.00
141_V	150_V	2.208	1.00
55_S	87_Y	2.205	1.00
20_V	46_I	2.157	1.00
22_Y	176_I	2.115	1.00
140_R	156_S	2.110	1.00
35_P	38_E	2.104	1.00
23_L	180_K	2.042	1.00
82_H	162_G	1.939	1.00
174_R	177_E	1.916	1.00
92_V	134_E	1.915	1.00
143_A	152_A	1.891	1.00
5_L	17_L	1.890	1.00
19_N	176_I	1.814	1.00
112_D	154_A	1.793	1.00
141_V	144_S	1.740	1.00
30_I	34_K	1.707	1.00
61_M	88_V	1.706	1.00
177_E	180_K	1.691	1.00
8_Y	47_F	1.629	1.00
123_N	173_E	1.620	1.00
61_M	87_Y	1.609	1.00
155_N	159_S	1.600	1.00
153_M	162_G	1.548	1.00
122_L	174_R	1.538	1.00
138_G	157_S	1.533	1.00
94_R	131_E	1.518	1.00
180_K	184_G	1.480	1.00
67_Y	70_E	1.440	1.00
116_K	184_G	1.405	1.00
28_E	42_F	1.393	1.00
66_L	84_L	1.386	1.00
5_L	46_I	1.376	1.00
60_K	84_L	1.375	1.00
132_V	153_M	1.375	1.00
40_K	72_K	1.368	1.00
86_A	91_G	1.354	1.00
138_G	156_S	1.349	1.00
154_A	161_F	1.348	1.00
85_I	162_G	1.347	1.00
118_F	122_L	1.332	1.00
16_I	78_I	1.322	1.00
105_R	121_Q	1.305	1.00
3_V	44_C	1.296	1.00
181_N	184_G	1.295	1.00
139_F	153_M	1.288	1.00
86_A	136_P	1.281	1.00
89_L	160_I	1.276	1.00
82_H	132_V	1.276	1.00
101_Y	129_N	1.264	1.00
44_C	182_F	1.256	1.00
112_D	142_L	1.241	1.00
104_T	125_W	1.236	1.00
97_L	149_R	1.236	1.00
25_A	183_L	1.231	1.00
131_E	149_R	1.217	1.00
34_K	38_E	1.217	1.00
47_F	60_K	1.212	1.00
115_L	152_A	1.197	1.00
46_I	76_L	1.189	1.00
66_L	70_E	1.182	1.00
9_G	33_H	1.181	1.00
106_I	123_N	1.179	1.00
139_F	155_N	1.173	1.00
40_K	68_I	1.157	1.00
135_P	141_V	1.152	1.00
144_S	148_A	1.134	1.00
55_S	92_V	1.128	1.00
106_I	121_Q	1.122	1.00
82_H	153_M	1.118	1.00
16_I	179_F	1.093	1.00
89_L	139_F	1.091	1.00
72_K	158_N	1.079	1.00
125_W	171_H	1.054	1.00
107_N	121_Q	1.049	1.00
107_N	124_V	1.040	1.00
110_D	140_R	1.034	1.00
70_E	158_N	1.028	1.00
122_L	178_I	1.021	1.00
76_L	163_V	1.017	1.00
67_Y	71_L	1.009	1.00
19_N	22_Y	1.007	1.00
96_A	131_E	1.007	1.00
3_V	25_A	1.003	1.00
161_F	185_V	1.002	1.00
109_F	144_S	1.001	1.00
45_V	73_V	0.989	1.00
93_V	132_V	0.977	1.00
8_Y	60_K	0.975	1.00
36_V	40_K	0.975	1.00
113_T	154_A	0.975	1.00
79_C	166_H	0.968	1.00
156_S	159_S	0.967	1.00
37_E	40_K	0.964	1.00
110_D	144_S	0.960	1.00
52_Y	56_E	0.953	1.00
45_V	65_P	0.949	1.00
70_E	160_I	0.947	1.00
138_G	155_N	0.947	1.00
34_K	39_L	0.939	1.00
4_G	42_F	0.935	1.00
6_V	30_I	0.932	1.00
78_I	163_V	0.928	1.00
5_L	12_Y	0.926	1.00
91_G	136_P	0.911	1.00
135_P	150_V	0.901	1.00
107_N	144_S	0.898	1.00
165_F	178_I	0.897	1.00
104_T	123_N	0.892	1.00
108_I	144_S	0.889	1.00
145_S	149_R	0.888	1.00
23_L	183_L	0.887	1.00
18_K	21_K	0.885	1.00
113_T	161_F	0.884	1.00
17_L	21_K	0.880	1.00
119_S	173_E	0.879	1.00
53_S	56_E	0.877	1.00
15_L	18_K	0.875	1.00
8_Y	32_P	0.870	1.00
40_K	73_V	0.864	1.00
44_C	183_L	0.853	1.00
112_D	140_R	0.851	1.00
20_V	25_A	0.851	1.00
21_K	27_I	0.851	1.00
47_F	75_M	0.851	1.00
23_L	176_I	0.849	1.00
50_G	80_L	0.844	1.00
95_R	99_P	0.839	1.00
23_L	179_F	0.832	1.00
142_L	152_A	0.832	1.00
68_I	71_L	0.828	1.00
4_G	39_L	0.822	1.00
115_L	165_F	0.818	1.00
119_S	122_L	0.814	1.00
118_F	174_R	0.814	1.00
108_I	120_Q	0.812	1.00
105_R	123_N	0.809	1.00
61_M	84_L	0.806	1.00
66_L	71_L	0.804	1.00
42_F	73_V	0.802	1.00
40_K	71_L	0.800	1.00
108_I	121_Q	0.796	1.00
9_G	31_P	0.795	1.00
143_A	165_F	0.789	1.00
71_L	158_N	0.770	1.00
3_V	20_V	0.767	1.00
57_E	60_K	0.766	1.00
24_G	27_I	0.765	1.00
30_I	38_E	0.764	1.00
5_L	20_V	0.763	1.00
142_L	161_F	0.761	1.00
14_H	17_L	0.759	1.00
59_Q	65_P	0.758	1.00
91_G	134_E	0.756	1.00
105_R	146_A	0.754	1.00
163_V	167_P	0.753	1.00
55_S	93_V	0.747	1.00
79_C	83_Q	0.745	1.00
39_L	42_F	0.743	1.00
112_D	161_F	0.743	1.00
65_P	69_K	0.740	1.00
124_V	172_T	0.739	1.00
176_I	180_K	0.735	1.00
111_E	120_Q	0.731	1.00
61_M	66_L	0.731	1.00
126_E	151_Q	0.730	1.00
66_L	88_V	0.729	1.00
91_G	132_V	0.726	1.00
53_S	130_D	0.723	1.00
12_Y	17_L	0.721	1.00
89_L	155_N	0.719	1.00
99_P	129_N	0.711	1.00
34_K	37_E	0.706	1.00
20_V	183_L	0.705	1.00
55_S	61_M	0.703	1.00
7_Y	13_N	0.702	1.00
114_I	161_F	0.701	1.00
98_N	147_N	0.700	1.00
57_E	61_M	0.696	1.00
136_P	139_F	0.693	1.00
37_E	68_I	0.691	1.00
53_S	95_R	0.684	1.00
110_D	142_L	0.683	1.00
118_F	177_E	0.680	1.00
161_F	182_F	0.679	1.00
101_Y	127_S	0.676	1.00
68_I	72_K	0.675	1.00
25_A	44_C	0.673	1.00
20_V	179_F	0.673	1.00
45_V	75_M	0.668	1.00
46_I	182_F	0.658	1.00
6_V	39_L	0.655	1.00
154_A	181_N	0.654	1.00
75_M	85_I	0.653	1.00
4_G	28_E	0.651	1.00
87_Y	92_V	0.650	1.00
134_E	137_S	0.640	1.00
69_K	75_M	0.637	1.00
117_G	181_N	0.634	1.00
103_L	125_W	0.632	1.00
108_I	146_A	0.631	1.00
65_P	68_I	0.628	1.00
54_V	87_Y	0.626	1.00
89_L	158_N	0.621	1.00
5_L	13_N	0.621	1.00
109_F	121_Q	0.620	1.00
13_N	29_V	0.615	1.00
18_K	22_Y	0.610	1.00
69_K	73_V	0.608	1.00
93_V	130_D	0.608	1.00
58_I	61_M	0.605	1.00
52_Y	55_S	0.600	1.00
15_L	19_N	0.599	1.00
155_N	160_I	0.597	1.00
61_M	65_P	0.597	1.00
165_F	175_G	0.594	1.00
53_S	87_Y	0.594	1.00
55_S	130_D	0.589	1.00
100_E	145_S	0.584	1.00
6_V	34_K	0.583	1.00
19_N	179_F	0.570	0.99
109_F	113_T	0.569	0.99
5_L	27_I	0.568	0.99
118_F	178_I	0.564	0.99
163_V	178_I	0.558	0.99
69_K	85_I	0.558	0.99
4_G	34_K	0.556	0.99
65_P	84_L	0.554	0.99
44_C	74_P	0.553	0.99
66_L	72_K	0.547	0.99
41_K	73_V	0.547	0.99
76_L	178_I	0.547	0.99
13_N	48_S	0.547	0.99
36_V	39_L	0.546	0.99
17_L	29_V	0.543	0.99
87_Y	93_V	0.542	0.99
44_C	76_L	0.542	0.99
35_P	39_L	0.537	0.99
177_E	181_N	0.532	0.99
131_E	148_A	0.529	0.99
49_G	79_C	0.524	0.99
75_M	160_I	0.524	0.99
36_V	68_I	0.521	0.99
106_I	143_A	0.520	0.99
125_W	173_E	0.520	0.99
84_L	88_V	0.520	0.99
8_Y	84_L	0.517	0.99
79_C	128_H	0.516	0.99
125_W	169_V	0.515	0.99
83_Q	164_Q	0.514	0.99
96_A	149_R	0.510	0.99
180_K	183_L	0.507	0.99
45_V	68_I	0.505	0.99
109_F	122_L	0.504	0.99
100_E	103_L	0.504	0.99
94_R	149_R	0.503	0.99
137_S	156_S	0.503	0.99
27_I	30_I	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3tqiA	3	0.9149	100	0.18	Contact Map
2ywbA	4	0.9628	100	0.184	Contact Map
1gpmA	3	0.9894	100	0.192	Contact Map
2vxoA	2	0.9681	100	0.205	Contact Map
3uowA	2	0.9947	100	0.224	Contact Map
3r75A	2	0.9787	100	0.253	Contact Map
1a9xB	1	0.9521	100	0.258	Contact Map
2vpiA	1	0.9362	100	0.264	Contact Map
1qdlB	2	0.9894	100	0.266	Contact Map
1i1qB	1	0.9521	100	0.268	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.008 seconds.