Q97VZ7 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97VZ7 - Uncharacterized protein

UniProt:	Q97VZ7	Sequences: MYWVRRKTIGGSGLPYTENEILEWRKEGVKRVLVLPEDWEIEESWGDKDYYLSILKKNGLQPLHIPIPDGGVPSDSQFLTIMKWLLSEKEGNLVHCVGGIGRTGTILASYLILTEGLEVESAIDEVRLVRPGAVQTYEQEMFLLRVEGMRKSWLKNIYSNS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	161 (148)
Sequences:	3268 (2171)
Seq/√Len:	178.5

SULSO - Q97VZ7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
29_V	93_L	4.797	1.00
11_G	103_T	3.216	1.00
108_A	123_I	2.901	1.00
9_I	110_Y	2.536	1.00
44_S	47_D	2.498	1.00
11_G	107_L	2.496	1.00
109_S	146_V	2.447	1.00
108_A	143_L	2.438	1.00
24_W	93_L	2.426	1.00
100_I	132_G	2.257	1.00
50_Y	53_S	2.190	1.00
17_T	47_D	2.174	1.00
111_L	122_A	2.107	1.00
112_I	122_A	2.074	1.00
113_L	150_R	2.068	1.00
21_I	24_W	2.045	1.00
23_E	93_L	1.912	1.00
118_E	121_S	1.857	1.00
25_R	57_K	1.844	1.00
68_P	71_G	1.813	1.00
13_G	16_Y	1.730	1.00
108_A	126_V	1.728	1.00
28_G	57_K	1.701	1.00
11_G	133_A	1.685	1.00
12_S	93_L	1.684	1.00
98_G	101_G	1.646	1.00
64_H	81_I	1.642	1.00
112_I	147_E	1.632	1.00
126_V	133_A	1.615	1.00
119_V	144_L	1.611	1.00
76_S	149_M	1.571	1.00
96_C	103_T	1.564	1.00
123_I	134_V	1.550	1.00
40_E	45_W	1.541	1.00
69_D	98_G	1.538	1.00
22_L	26_K	1.535	1.00
34_V	61_Q	1.499	1.00
109_S	143_L	1.435	1.00
14_L	46_G	1.421	1.00
67_I	73_P	1.398	1.00
62_P	85_L	1.396	1.00
112_I	119_V	1.355	1.00
48_K	56_K	1.295	1.00
73_P	142_F	1.294	1.00
64_H	67_I	1.273	1.00
29_V	90_E	1.269	1.00
98_G	135_Q	1.257	1.00
36_P	46_G	1.251	1.00
127_R	134_V	1.238	1.00
120_E	124_D	1.228	1.00
85_L	106_I	1.213	1.00
101_G	135_Q	1.208	1.00
12_S	20_E	1.201	1.00
61_Q	95_H	1.181	1.00
33_L	106_I	1.174	1.00
119_V	143_L	1.155	1.00
61_Q	67_I	1.152	1.00
48_K	55_L	1.127	1.00
48_K	52_L	1.123	1.00
97_V	102_R	1.117	1.00
125_E	128_L	1.110	1.00
111_L	126_V	1.109	1.00
123_I	127_R	1.098	1.00
105_T	109_S	1.095	1.00
78_F	81_I	1.091	1.00
64_H	73_P	1.067	1.00
50_Y	54_I	1.061	1.00
121_S	124_D	1.059	1.00
134_V	143_L	1.056	1.00
123_I	133_A	1.054	1.00
37_E	65_I	1.043	1.00
42_E	46_G	1.041	1.00
68_P	73_P	1.028	0.99
98_G	102_R	1.028	0.99
68_P	72_V	1.018	0.99
48_K	51_Y	1.013	0.99
39_W	42_E	1.000	0.99
17_T	44_S	0.993	0.99
120_E	140_E	0.980	0.99
14_L	98_G	0.972	0.99
140_E	144_L	0.969	0.99
141_M	145_R	0.965	0.99
141_M	144_L	0.943	0.99
107_L	133_A	0.936	0.99
33_L	85_L	0.928	0.99
127_R	130_R	0.927	0.99
31_R	62_P	0.918	0.99
79_L	150_R	0.913	0.99
13_G	19_N	0.912	0.99
99_G	102_R	0.892	0.99
19_N	22_L	0.889	0.98
19_N	23_E	0.882	0.98
97_V	101_G	0.882	0.98
36_P	45_W	0.881	0.98
149_M	153_W	0.873	0.98
78_F	109_S	0.866	0.98
141_M	148_G	0.863	0.98
94_V	107_L	0.860	0.98
34_V	38_D	0.856	0.98
23_E	34_V	0.848	0.98
33_L	81_I	0.844	0.98
42_E	45_W	0.838	0.98
49_D	56_K	0.832	0.98
99_G	103_T	0.830	0.98
101_G	104_G	0.829	0.98
99_G	130_R	0.828	0.98
24_W	29_V	0.825	0.98
28_G	55_L	0.819	0.97
59_G	67_I	0.808	0.97
97_V	135_Q	0.806	0.97
48_K	53_S	0.791	0.97
119_V	122_A	0.780	0.97
94_V	106_I	0.779	0.97
14_L	21_I	0.777	0.96
111_L	125_E	0.775	0.96
66_P	76_S	0.774	0.96
14_L	36_P	0.773	0.96
57_K	67_I	0.769	0.96
134_V	139_Q	0.767	0.96
140_E	143_L	0.767	0.96
15_P	35_L	0.761	0.96
62_P	67_I	0.748	0.96
20_E	24_W	0.745	0.96
78_F	82_M	0.744	0.95
62_P	81_I	0.739	0.95
9_I	21_I	0.738	0.95
64_H	79_L	0.734	0.95
40_E	46_G	0.732	0.95
40_E	43_E	0.732	0.95
82_M	106_I	0.730	0.95
114_T	117_L	0.728	0.95
30_K	90_E	0.727	0.95
35_L	100_I	0.717	0.95
98_G	103_T	0.715	0.94
123_I	143_L	0.714	0.94
142_F	146_V	0.711	0.94
122_A	126_V	0.706	0.94
14_L	97_V	0.706	0.94
135_Q	139_Q	0.701	0.94
48_K	54_I	0.699	0.94
24_W	32_V	0.698	0.94
98_G	139_Q	0.693	0.93
50_Y	55_L	0.693	0.93
95_H	103_T	0.692	0.93
126_V	129_V	0.685	0.93
101_G	134_V	0.684	0.93
34_V	63_L	0.676	0.93
34_V	95_H	0.670	0.92
104_G	133_A	0.669	0.92
99_G	104_G	0.669	0.92
43_E	47_D	0.666	0.92
28_G	88_E	0.660	0.92
69_D	96_C	0.659	0.92
31_R	85_L	0.658	0.92
85_L	92_N	0.654	0.91
96_C	139_Q	0.653	0.91
124_D	128_L	0.646	0.91
28_G	89_K	0.643	0.91
86_L	89_K	0.643	0.91
16_Y	19_N	0.637	0.90
77_Q	149_M	0.634	0.90
10_G	29_V	0.632	0.90
108_A	112_I	0.629	0.90
110_Y	113_L	0.629	0.90
98_G	104_G	0.627	0.90
147_E	151_K	0.626	0.89
69_D	135_Q	0.624	0.89
69_D	97_V	0.616	0.89
108_A	122_A	0.614	0.89
25_R	59_G	0.611	0.88
102_R	130_R	0.610	0.88
49_D	53_S	0.609	0.88
101_G	105_T	0.601	0.88
9_I	111_L	0.599	0.87
31_R	60_L	0.597	0.87
18_E	51_Y	0.590	0.87
34_V	46_G	0.586	0.86
9_I	107_L	0.583	0.86
14_L	45_W	0.582	0.86
45_W	69_D	0.580	0.86
52_L	55_L	0.579	0.86
138_E	146_V	0.572	0.85
78_F	142_F	0.569	0.85
10_G	27_E	0.566	0.84
49_D	52_L	0.564	0.84
64_H	142_F	0.563	0.84
76_S	79_L	0.563	0.84
83_K	153_W	0.563	0.84
18_E	22_L	0.563	0.84
114_T	118_E	0.562	0.84
105_T	134_V	0.560	0.84
107_L	143_L	0.560	0.84
76_S	142_F	0.559	0.83
45_W	135_Q	0.558	0.83
21_I	34_V	0.551	0.83
104_G	134_V	0.549	0.82
121_S	125_E	0.549	0.82
51_Y	88_E	0.549	0.82
97_V	103_T	0.546	0.82
76_S	146_V	0.544	0.82
70_G	98_G	0.543	0.82
31_R	129_V	0.543	0.82
25_R	43_E	0.543	0.82
14_L	34_V	0.542	0.82
107_L	110_Y	0.537	0.81
23_E	26_K	0.535	0.81
21_I	59_G	0.533	0.81
45_W	98_G	0.531	0.80
30_K	89_K	0.531	0.80
79_L	82_M	0.527	0.80
119_V	123_I	0.519	0.79
120_E	131_P	0.518	0.79
52_L	56_K	0.517	0.79
107_L	112_I	0.517	0.79
53_S	58_N	0.515	0.78
28_G	90_E	0.514	0.78
39_W	44_S	0.513	0.78
51_Y	56_K	0.511	0.78
36_P	40_E	0.510	0.78
123_I	140_E	0.503	0.77
98_G	105_T	0.500	0.76
145_R	151_K	0.500	0.76

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1ygrA	1	0.9627	100	0.126	Contact Map
1larA	1	0.9565	100	0.129	Contact Map
2jjdA	1	0.9379	100	0.131	Contact Map
2nlkA	1	1	100	0.134	Contact Map
3ps5A	2	1	100	0.135	Contact Map
2h4vA	1	0.9379	100	0.136	Contact Map
1yfoA	1	0.9317	100	0.142	Contact Map
3i36A	1	0.9627	100	0.143	Contact Map
2b3oA	1	1	100	0.147	Contact Map
2ooqA	1	0.9503	100	0.151	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.