Q97VY7 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97VY7 - Biotin carboxyl carrier protein of propionyl-CoA carboxylase beta subunit

UniProt:	Q97VY7	Sequences: MENLWYHIPILSKGVVVMRLFRLYSELGDMYLVSYEQSNNSLDKIKIGDKNYEVKYLGSGNRENEYLFEINGKKYYVFIESDGTLIFNHQDFLRLDKVTEIPIKGEERVEEIIRGKEGEIVSPLFGRVVKIRVKEGDAVNKGQPLLSIEAMKAETVISSPIGGIVQKILIKEGQGVKKGDILIVIK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	186 (154)
Sequences:	2103 (1839)
Seq/√Len:	148.2

BACSU - PYC
HALSA - Q9HPP8
SULSO - Q97VY7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
140_N	162_G	6.734	1.00
134_K	137_D	5.853	1.00
137_D	143_Q	4.103	1.00
144_P	156_V	3.906	1.00
135_E	167_K	3.352	1.00
140_N	143_Q	3.297	1.00
167_K	184_V	3.255	1.00
130_K	172_E	2.822	1.00
131_I	168_I	2.736	1.00
171_K	174_Q	2.688	1.00
133_V	165_V	2.666	1.00
138_A	164_I	2.601	1.00
166_Q	184_V	2.429	1.00
122_S	148_I	2.420	1.00
146_L	182_L	2.394	1.00
176_V	182_L	2.378	1.00
150_A	155_T	2.273	1.00
141_K	162_G	2.219	1.00
67_L	74_K	2.014	1.00
145_L	183_I	1.906	1.00
135_E	168_I	1.765	1.00
169_L	181_I	1.745	1.00
128_V	182_L	1.701	1.00
177_K	180_D	1.693	1.00
42_L	53_E	1.613	1.00
46_K	49_D	1.514	1.00
132_R	144_P	1.491	1.00
90_Q	93_L	1.472	1.00
46_K	51_N	1.432	1.00
129_V	149_E	1.411	1.00
174_Q	180_D	1.401	1.00
166_Q	185_I	1.388	1.00
55_K	69_E	1.381	1.00
170_I	180_D	1.378	1.00
123_P	157_I	1.378	1.00
99_T	102_P	1.350	1.00
128_V	148_I	1.314	1.00
128_V	131_I	1.296	1.00
133_V	137_D	1.288	1.00
65_E	76_Y	1.284	1.00
44_K	53_E	1.261	1.00
68_F	77_V	1.222	1.00
92_F	95_L	1.221	1.00
67_L	76_Y	1.206	1.00
52_Y	71_N	1.190	1.00
161_I	185_I	1.167	1.00
168_I	183_I	1.166	1.00
155_T	175_G	1.156	1.00
54_V	70_I	1.149	1.00
88_N	92_F	1.141	1.00
44_K	51_N	1.135	0.99
69_E	74_K	1.132	0.99
85_L	96_D	1.129	0.99
144_P	158_S	1.110	0.99
90_Q	95_L	1.095	0.99
148_I	179_G	1.078	0.99
33_V	36_E	1.069	0.99
132_R	146_L	1.064	0.99
118_G	185_I	1.047	0.99
128_V	146_L	1.032	0.99
163_G	185_I	1.020	0.99
33_V	45_I	1.020	0.99
33_V	47_I	1.015	0.99
118_G	155_T	1.015	0.99
32_L	36_E	1.012	0.99
120_I	129_V	1.011	0.99
34_S	46_K	0.992	0.99
118_G	161_I	0.977	0.98
126_G	150_A	0.963	0.98
128_V	165_V	0.960	0.98
127_R	175_G	0.958	0.98
125_F	178_K	0.949	0.98
126_G	155_T	0.944	0.98
119_E	181_I	0.942	0.98
101_I	104_K	0.933	0.98
118_G	175_G	0.928	0.98
149_E	173_G	0.897	0.97
150_A	176_V	0.889	0.97
170_I	178_K	0.882	0.97
148_I	170_I	0.878	0.97
132_R	147_S	0.875	0.97
125_F	175_G	0.868	0.97
35_Y	45_I	0.857	0.97
150_A	153_A	0.855	0.96
119_E	184_V	0.850	0.96
90_Q	97_K	0.847	0.96
131_I	146_L	0.845	0.96
39_N	42_L	0.818	0.95
42_L	55_K	0.816	0.95
124_L	155_T	0.814	0.95
124_L	150_A	0.812	0.95
104_K	107_E	0.807	0.95
44_K	47_I	0.806	0.95
30_M	36_E	0.802	0.95
157_I	169_L	0.799	0.95
175_G	178_K	0.798	0.95
36_E	44_K	0.789	0.95
127_R	155_T	0.788	0.94
135_E	171_K	0.785	0.94
146_L	176_V	0.782	0.94
130_K	154_E	0.776	0.94
125_F	179_G	0.770	0.94
41_S	45_I	0.770	0.94
165_V	183_I	0.768	0.94
31_Y	34_S	0.768	0.94
128_V	170_I	0.767	0.94
128_V	183_I	0.764	0.94
97_K	105_G	0.757	0.93
132_R	135_E	0.755	0.93
120_I	183_I	0.752	0.93
146_L	183_I	0.752	0.93
85_L	88_N	0.743	0.93
120_I	170_I	0.738	0.92
146_L	157_I	0.734	0.92
40_N	44_K	0.727	0.92
148_I	178_K	0.725	0.92
116_K	119_E	0.722	0.91
129_V	147_S	0.721	0.91
33_V	39_N	0.718	0.91
105_G	108_R	0.717	0.91
43_D	46_K	0.716	0.91
84_T	93_L	0.714	0.91
125_F	177_K	0.711	0.91
144_P	147_S	0.708	0.91
31_Y	35_Y	0.705	0.90
36_E	46_K	0.703	0.90
113_I	116_K	0.698	0.90
157_I	170_I	0.696	0.90
175_G	179_G	0.696	0.90
145_L	157_I	0.688	0.89
109_V	165_V	0.687	0.89
50_K	65_E	0.685	0.89
49_D	52_Y	0.684	0.89
71_N	74_K	0.684	0.89
176_V	179_G	0.683	0.89
38_S	53_E	0.682	0.89
55_K	67_L	0.680	0.89
120_I	149_E	0.676	0.89
169_L	184_V	0.675	0.88
109_V	116_K	0.667	0.88
170_I	175_G	0.664	0.88
87_F	94_R	0.661	0.87
125_F	128_V	0.659	0.87
87_F	92_F	0.657	0.87
146_L	168_I	0.654	0.87
40_N	51_N	0.652	0.87
30_M	34_S	0.649	0.86
51_N	81_S	0.649	0.86
61_N	64_N	0.649	0.86
91_D	95_L	0.645	0.86
174_Q	177_K	0.642	0.86
58_G	62_R	0.640	0.86
41_S	53_E	0.633	0.85
89_H	178_K	0.632	0.85
33_V	41_S	0.631	0.85
122_S	125_F	0.626	0.84
32_L	37_Q	0.626	0.84
38_S	42_L	0.623	0.84
168_I	185_I	0.623	0.84
127_R	178_K	0.622	0.84
155_T	170_I	0.620	0.84
68_F	75_Y	0.616	0.84
65_E	81_S	0.615	0.83
117_E	160_P	0.614	0.83
124_L	177_K	0.612	0.83
111_E	179_G	0.611	0.83
170_I	181_I	0.606	0.83
32_L	48_G	0.605	0.82
165_V	172_E	0.605	0.82
148_I	155_T	0.603	0.82
133_V	168_I	0.603	0.82
68_F	147_S	0.600	0.82
139_V	163_G	0.599	0.82
138_A	162_G	0.596	0.81
90_Q	99_T	0.595	0.81
31_Y	36_E	0.591	0.81
156_V	178_K	0.590	0.81
58_G	61_N	0.590	0.81
73_K	110_E	0.586	0.80
53_E	65_E	0.586	0.80
75_Y	78_F	0.585	0.80
35_Y	38_S	0.585	0.80
97_K	108_R	0.584	0.80
69_E	78_F	0.581	0.80
86_I	96_D	0.579	0.80
169_L	180_D	0.579	0.80
65_E	78_F	0.578	0.80
149_E	178_K	0.576	0.79
33_V	40_N	0.576	0.79
69_E	72_G	0.575	0.79
121_V	150_A	0.574	0.79
32_L	35_Y	0.573	0.79
95_L	99_T	0.573	0.79
37_Q	40_N	0.572	0.79
135_E	166_Q	0.567	0.78
99_T	104_K	0.565	0.78
92_F	99_T	0.562	0.78
57_L	141_K	0.556	0.77
35_Y	49_D	0.553	0.76
75_Y	79_I	0.552	0.76
89_H	93_L	0.550	0.76
34_S	38_S	0.544	0.75
95_L	98_V	0.543	0.75
35_Y	39_N	0.542	0.75
51_N	114_R	0.540	0.75
86_I	90_Q	0.538	0.75
40_N	53_E	0.538	0.75
46_K	55_K	0.537	0.74
88_N	104_K	0.536	0.74
150_A	178_K	0.530	0.73
127_R	177_K	0.529	0.73
84_T	97_K	0.526	0.73
30_M	33_V	0.526	0.73
58_G	66_Y	0.525	0.73
90_Q	94_R	0.520	0.72
118_G	182_L	0.517	0.72
40_N	72_G	0.515	0.71
127_R	174_Q	0.514	0.71
177_K	185_I	0.514	0.71
66_Y	77_V	0.513	0.71
135_E	138_A	0.513	0.71
123_P	180_D	0.512	0.71
127_R	157_I	0.511	0.71
130_K	179_G	0.511	0.71
94_R	99_T	0.509	0.70
91_D	97_K	0.508	0.70
132_R	168_I	0.508	0.70
125_F	153_A	0.507	0.70
89_H	94_R	0.503	0.70
122_S	147_S	0.501	0.69
43_D	56_Y	0.500	0.69

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3n6rA	1	0.9731	100	0.371	Contact Map
3u9tA	3	0.4839	100	0.399	Contact Map
4qshA	4	0.8817	99.9	0.491	Contact Map
3bg3A	4	0.8763	99.9	0.492	Contact Map
2qf7A	4	0.871	99.9	0.497	Contact Map
3va7A	1	0.9462	99.9	0.511	Contact Map
3hblA	4	0.9032	99.9	0.519	Contact Map
4rcnA	6	0.9677	99.9	0.555	Contact Map
4hr7B	1	0.3925	99.7	0.611	Contact Map
2kccA	1	0.3925	99.7	0.623	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.