OGT - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

OGT - Methylated-DNA--protein-cysteine methyltransferase

UniProt:	Q97VW7	Sequences: MLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVMKIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPCHRVIAENGIGGYSRGVKLKRALLELEGVKIPE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	151 (143)
Sequences:	6152 (4570)
Seq/√Len:	382.2

ECOLI - OGT ADA
BACSU - OGT ADAB
SULSO - OGT

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
124_A	129_G	3.184	1.00
51_L	57_P	3.019	1.00
140_A	144_L	2.767	1.00
74_S	99_T	2.740	1.00
78_E	81_K	2.732	1.00
88_M	96_S	2.569	1.00
91_K	125_E	2.397	1.00
88_M	92_Q	2.289	1.00
68_T	76_F	2.239	1.00
19_D	65_N	2.195	1.00
139_R	143_E	2.113	1.00
8_K	13_Y	2.049	1.00
78_E	96_S	2.041	1.00
91_K	95_D	1.971	1.00
78_E	93_I	1.929	1.00
66_L	117_I	1.911	1.00
19_D	22_G	1.860	1.00
88_M	93_I	1.803	1.00
5_G	46_F	1.801	1.00
18_K	42_F	1.778	1.00
16_V	23_F	1.691	1.00
51_L	56_K	1.688	1.00
6_L	13_Y	1.650	1.00
48_K	60_L	1.616	1.00
69_Y	72_R	1.602	1.00
79_V	108_L	1.595	1.00
26_L	116_I	1.555	1.00
92_Q	95_D	1.541	1.00
77_K	80_M	1.505	1.00
72_R	110_K	1.499	1.00
7_Y	50_D	1.482	1.00
44_E	48_K	1.478	1.00
75_V	93_I	1.432	1.00
91_K	101_P	1.418	1.00
48_K	62_E	1.413	1.00
68_T	72_R	1.399	1.00
19_D	24_I	1.370	1.00
82_I	88_M	1.355	1.00
81_K	96_S	1.349	1.00
130_G	135_V	1.337	1.00
82_I	122_V	1.330	1.00
22_G	65_N	1.316	1.00
88_M	122_V	1.304	1.00
101_P	105_G	1.300	1.00
140_A	143_E	1.293	1.00
128_I	135_V	1.283	1.00
78_E	97_L	1.266	1.00
44_E	47_H	1.258	1.00
28_F	137_L	1.250	1.00
16_V	45_F	1.238	1.00
109_S	129_G	1.238	1.00
143_E	146_G	1.226	1.00
106_M	109_S	1.216	1.00
73_L	77_K	1.212	1.00
17_A	25_M	1.189	1.00
106_M	110_K	1.180	1.00
46_F	50_D	1.173	1.00
114_L	133_R	1.167	1.00
10_P	53_F	1.158	1.00
28_F	114_L	1.147	1.00
66_L	73_L	1.097	1.00
45_F	116_I	1.088	1.00
106_M	129_G	1.075	1.00
80_M	117_I	1.056	1.00
64_I	113_I	1.053	1.00
77_K	81_K	1.049	1.00
66_L	112_P	1.040	1.00
9_S	14_I	1.034	1.00
48_K	57_P	1.027	1.00
48_K	61_R	1.022	1.00
62_E	116_I	1.020	1.00
18_K	39_D	1.016	1.00
38_D	43_T	1.014	1.00
18_K	45_F	1.013	1.00
9_S	12_G	1.012	1.00
30_D	137_L	1.010	1.00
6_L	15_T	0.997	1.00
47_H	51_L	0.994	1.00
7_Y	46_F	0.987	1.00
21_K	65_N	0.977	1.00
87_V	142_L	0.970	1.00
71_F	103_A	0.960	1.00
23_F	45_F	0.956	1.00
66_L	113_I	0.954	1.00
15_T	29_C	0.949	1.00
70_P	73_L	0.949	1.00
17_A	24_I	0.948	1.00
50_D	54_E	0.946	1.00
39_D	42_F	0.942	1.00
129_G	135_V	0.929	1.00
49_L	53_F	0.926	1.00
108_L	123_I	0.923	1.00
109_S	134_G	0.914	1.00
136_K	139_R	0.909	1.00
13_Y	29_C	0.907	1.00
48_K	58_I	0.907	1.00
11_L	140_A	0.896	1.00
11_L	137_L	0.888	1.00
137_L	140_A	0.888	1.00
58_I	84_W	0.878	1.00
97_L	104_V	0.876	1.00
83_P	86_K	0.874	1.00
5_G	42_F	0.870	1.00
78_E	88_M	0.868	1.00
105_G	109_S	0.861	1.00
41_S	44_E	0.850	1.00
52_Y	144_L	0.846	1.00
24_I	67_K	0.843	1.00
14_I	26_L	0.841	1.00
108_L	131_Y	0.841	1.00
109_S	132_S	0.830	1.00
26_L	49_L	0.828	1.00
15_T	27_D	0.802	1.00
93_I	108_L	0.793	1.00
72_R	76_F	0.792	1.00
108_L	114_L	0.787	1.00
70_P	74_S	0.787	1.00
41_S	63_P	0.783	1.00
18_K	21_K	0.779	1.00
71_F	107_A	0.779	1.00
42_F	45_F	0.777	1.00
75_V	97_L	0.776	1.00
31_C	34_G	0.775	1.00
72_R	106_M	0.775	1.00
11_L	14_I	0.773	1.00
97_L	100_S	0.772	1.00
100_S	103_A	0.771	1.00
16_V	42_F	0.767	1.00
124_A	130_G	0.762	1.00
128_I	139_R	0.758	1.00
114_L	132_S	0.751	1.00
31_C	35_N	0.745	1.00
5_G	43_T	0.741	1.00
111_N	119_C	0.739	1.00
16_V	26_L	0.737	1.00
27_D	114_L	0.734	1.00
143_E	147_V	0.707	1.00
74_S	77_K	0.707	1.00
93_I	105_G	0.698	0.99
22_G	41_S	0.697	0.99
71_F	75_V	0.694	0.99
74_S	97_L	0.690	0.99
26_L	113_I	0.674	0.99
26_L	114_L	0.673	0.99
18_K	41_S	0.670	0.99
34_G	37_R	0.669	0.99
41_S	45_F	0.668	0.99
114_L	137_L	0.668	0.99
115_L	144_L	0.668	0.99
89_T	125_E	0.655	0.99
57_P	84_W	0.642	0.99
66_L	76_F	0.642	0.99
50_D	53_F	0.637	0.99
93_I	104_V	0.637	0.99
67_K	73_L	0.634	0.99
33_E	37_R	0.630	0.99
75_V	104_V	0.630	0.99
113_I	117_I	0.626	0.99
6_L	29_C	0.623	0.99
25_M	114_L	0.622	0.99
45_F	48_K	0.620	0.99
33_E	36_S	0.612	0.99
22_G	63_P	0.605	0.99
91_K	105_G	0.604	0.99
24_I	65_N	0.603	0.99
64_I	80_M	0.603	0.99
135_V	139_R	0.602	0.98
84_W	144_L	0.602	0.98
76_F	79_V	0.601	0.98
40_S	43_T	0.599	0.98
7_Y	14_I	0.598	0.98
14_I	28_F	0.596	0.98
89_T	92_Q	0.586	0.98
68_T	73_L	0.584	0.98
49_L	52_Y	0.583	0.98
87_V	147_V	0.582	0.98
94_A	104_V	0.580	0.98
79_V	93_I	0.579	0.98
52_Y	60_L	0.572	0.98
92_Q	96_S	0.569	0.98
101_P	106_M	0.568	0.98
49_L	116_I	0.568	0.98
52_Y	115_L	0.568	0.98
17_A	27_D	0.567	0.98
82_I	108_L	0.563	0.98
43_T	47_H	0.563	0.98
115_L	141_L	0.562	0.98
49_L	115_L	0.561	0.98
55_G	84_W	0.557	0.98
129_G	132_S	0.555	0.97
47_H	50_D	0.555	0.97
87_V	123_I	0.551	0.97
113_I	116_I	0.549	0.97
35_N	38_D	0.547	0.97
124_A	135_V	0.547	0.97
25_M	105_G	0.545	0.97
53_F	144_L	0.545	0.97
89_T	124_A	0.543	0.97
7_Y	16_V	0.543	0.97
51_L	58_I	0.536	0.97
69_Y	102_R	0.535	0.97
32_V	36_S	0.534	0.97
32_V	35_N	0.533	0.97
124_A	128_I	0.527	0.97
9_S	137_L	0.523	0.96
88_M	108_L	0.523	0.96
66_L	80_M	0.519	0.96
57_P	61_R	0.517	0.96
48_K	51_L	0.515	0.96
79_V	122_V	0.514	0.96
131_Y	137_L	0.513	0.96
71_F	97_L	0.502	0.95
139_R	146_G	0.502	0.95
93_I	96_S	0.500	0.95

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1wrjA	1	0.9868	100	0.117	Contact Map
1sfeA	1	0.9801	100	0.149	Contact Map
4bhbA	1	1	100	0.155	Contact Map
3l00A	1	0.9536	100	0.176	Contact Map
1eh6A	1	0.9536	100	0.178	Contact Map
1mgtA	1	0.9073	100	0.26	Contact Map
2g7hA	1	0.9603	100	0.263	Contact Map
2kifA	1	0.5563	100	0.413	Contact Map
3gvaA	1	0.5629	100	0.417	Contact Map
3ugoA	1	0.3841	81.1	0.913	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0074 seconds.