Q97VT0 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97VT0 - Uncharacterized protein

UniProt:	Q97VT0	Sequences: MMREEAQKWFRQALEDLATAKDTITTGHYYASAFWAEQAAEKALKALLIENGKIERTHDLNQLLYVIKEEIGLPVEEIRSEVNKLTLHYTISRYPDAANTIPYSLYTKEDAEELVKKAEKVIEWVRRNLH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	130 (117)
Sequences:	456 (419)
Seq/√Len:	38.7

SULSO - Q97VT0 Q97XR7 Q97XB1 Q97XN9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
21_K	119_E	5.924	1.00
14_L	126_R	4.730	1.00
5_E	8_K	3.640	1.00
16_D	42_K	3.515	1.00
108_K	112_E	2.748	1.00
59_D	86_T	2.674	1.00
43_A	122_I	2.598	1.00
23_T	35_W	2.473	1.00
19_T	23_T	2.425	1.00
12_Q	30_Y	2.217	0.99
88_H	106_Y	2.164	0.99
81_E	117_K	2.160	0.99
31_A	35_W	2.098	0.99
44_L	60_L	1.996	0.99
16_D	35_W	1.785	0.97
116_K	119_E	1.611	0.95
12_Q	106_Y	1.592	0.95
47_L	67_I	1.570	0.94
40_A	85_L	1.509	0.93
47_L	75_V	1.500	0.93
87_L	110_D	1.497	0.93
64_L	82_V	1.455	0.92
14_L	122_I	1.453	0.92
22_D	26_T	1.446	0.92
10_F	43_A	1.433	0.91
22_D	28_H	1.432	0.91
15_E	30_Y	1.401	0.90
18_A	28_H	1.394	0.90
88_H	114_L	1.362	0.89
60_L	82_V	1.335	0.88
19_T	31_A	1.272	0.85
36_A	116_K	1.261	0.85
39_A	115_V	1.252	0.84
19_T	35_W	1.232	0.83
29_Y	111_A	1.230	0.83
23_T	31_A	1.205	0.82
84_K	113_E	1.196	0.81
51_N	67_I	1.186	0.81
42_K	95_P	1.184	0.81
10_F	46_A	1.184	0.81
107_T	110_D	1.172	0.80
60_L	86_T	1.164	0.80
13_A	43_A	1.154	0.79
75_V	124_W	1.147	0.79
86_T	89_Y	1.138	0.78
19_T	28_H	1.115	0.77
20_A	36_A	1.111	0.76
78_I	82_V	1.094	0.75
11_R	104_S	1.088	0.75
115_V	119_E	1.084	0.75
119_E	123_E	1.078	0.74
72_G	75_V	1.069	0.73
86_T	91_I	1.033	0.71
116_K	120_K	1.032	0.71
34_F	89_Y	1.018	0.70
16_D	23_T	1.006	0.69
33_A	114_L	1.005	0.69
17_L	118_A	0.997	0.68
81_E	120_K	0.981	0.67
24_I	33_A	0.963	0.65
24_I	111_A	0.953	0.65
68_K	75_V	0.932	0.63
85_L	118_A	0.928	0.62
36_A	118_A	0.901	0.60
67_I	75_V	0.899	0.60
34_F	90_T	0.897	0.60
78_I	121_V	0.895	0.60
40_A	121_V	0.848	0.56
15_E	23_T	0.844	0.55
51_N	75_V	0.844	0.55
21_K	115_V	0.834	0.54
110_D	114_L	0.834	0.54
24_I	115_V	0.833	0.54
13_A	80_S	0.825	0.53
16_D	95_P	0.819	0.53
42_K	56_R	0.815	0.53
48_L	110_D	0.812	0.52
34_F	93_R	0.809	0.52
23_T	42_K	0.786	0.50
45_K	58_H	0.784	0.50
48_L	67_I	0.771	0.49
6_A	13_A	0.763	0.48
18_A	21_K	0.749	0.47
110_D	117_K	0.748	0.47
64_L	78_I	0.745	0.46
80_S	109_E	0.739	0.46
17_L	65_Y	0.739	0.46
81_E	84_K	0.736	0.45
29_Y	32_S	0.735	0.45
106_Y	114_L	0.733	0.45
48_L	63_L	0.732	0.45
15_E	105_L	0.728	0.45
21_K	25_T	0.725	0.44
10_F	126_R	0.721	0.44
28_H	34_F	0.720	0.44
15_E	31_A	0.718	0.44
20_A	115_V	0.708	0.43
123_E	127_R	0.708	0.43
39_A	122_I	0.705	0.43
112_E	116_K	0.705	0.43
88_H	92_S	0.701	0.42
67_I	124_W	0.699	0.42
84_K	88_H	0.699	0.42
65_Y	82_V	0.691	0.41
89_Y	97_A	0.690	0.41
24_I	108_K	0.686	0.41
32_S	111_A	0.677	0.40
91_I	96_D	0.676	0.40
52_G	86_T	0.675	0.40
37_E	88_H	0.674	0.40
37_E	111_A	0.673	0.40
35_W	42_K	0.673	0.40
48_L	53_K	0.672	0.40
89_Y	92_S	0.671	0.40
51_N	73_L	0.670	0.40
86_T	90_T	0.667	0.39
9_W	94_Y	0.664	0.39
69_E	75_V	0.662	0.39
8_K	35_W	0.653	0.38
84_K	114_L	0.647	0.38
69_E	77_E	0.647	0.38
113_E	116_K	0.646	0.38
44_L	57_T	0.644	0.37
40_A	82_V	0.642	0.37
12_Q	103_Y	0.641	0.37
82_V	86_T	0.639	0.37
48_L	66_V	0.637	0.37
15_E	28_H	0.636	0.37
65_Y	84_K	0.634	0.37
9_W	95_P	0.632	0.36
76_E	79_R	0.616	0.35
47_L	80_S	0.612	0.35
16_D	19_T	0.612	0.35
60_L	87_L	0.612	0.35
115_V	122_I	0.610	0.35
116_K	125_V	0.607	0.34
52_G	118_A	0.602	0.34
12_Q	55_E	0.600	0.34
7_Q	108_K	0.594	0.33
73_L	120_K	0.594	0.33
13_A	39_A	0.592	0.33
17_L	52_G	0.589	0.33
25_T	120_K	0.581	0.32
17_L	21_K	0.580	0.32
33_A	110_D	0.578	0.32
5_E	49_I	0.573	0.32
15_E	22_D	0.565	0.31
36_A	111_A	0.562	0.31
77_E	120_K	0.562	0.31
57_T	91_I	0.560	0.31
34_F	91_I	0.560	0.31
33_A	88_H	0.558	0.30
53_K	66_V	0.552	0.30
47_L	73_L	0.552	0.30
83_N	107_T	0.552	0.30
6_A	50_E	0.551	0.30
109_E	121_V	0.547	0.30
28_H	31_A	0.545	0.29
82_V	121_V	0.544	0.29
8_K	49_I	0.537	0.29
87_L	107_T	0.528	0.28
48_L	52_G	0.528	0.28
47_L	51_N	0.527	0.28
47_L	125_V	0.526	0.28
84_K	117_K	0.526	0.28
10_F	122_I	0.525	0.28
37_E	86_T	0.521	0.28
8_K	57_T	0.521	0.28
12_Q	122_I	0.521	0.28
32_S	115_V	0.513	0.27
40_A	60_L	0.512	0.27
123_E	126_R	0.510	0.27
29_Y	34_F	0.507	0.27
12_Q	104_S	0.507	0.27
81_E	113_E	0.506	0.27
94_Y	127_R	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1ufbA	3	0.9692	100	0.283	Contact Map
3o10A	2	0.9923	100	0.284	Contact Map
1wolA	1	0.9308	100	0.31	Contact Map
1o3uA	2	0.9	100	0.351	Contact Map
4nqfA	2	0.9462	100	0.351	Contact Map
2hsbA	2	0.9308	99.9	0.419	Contact Map
2jpuA	1	0.8538	91.8	0.872	Contact Map
1knyA	2	0.8385	33.8	0.921	Contact Map
4hpqC	2	0.9462	33.3	0.921	Contact Map
3qwpA	1	0.9462	20.9	0.929	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.