Q97VP2 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97VP2 - Zinc-containing ferredoxin

UniProt:	Q97VP2	Sequences: MGIDPNYRTNFPVSGEHSGHKVYGTVEPPGKLGIHGTIVGVDFDLCIADGSCINACPVNVFQWYDTPGHPASEKKADPVNEQACIFCMACVNVCPVAAIDVKPP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	104 (84)
Sequences:	361 (271)
Seq/√Len:	29.6

HALSA - Q9HML0
SULSO - Q97VP2 Q97YU8 Q97V77 Q97V60

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
62_Q	65_D	5.464	1.00
51_S	54_N	3.279	1.00
21_K	35_H	2.728	1.00
23_Y	32_L	2.244	0.99
55_A	86_F	2.192	0.98
88_M	91_V	2.145	0.98
60_V	71_A	2.090	0.98
85_I	89_A	1.877	0.96
63_W	71_A	1.868	0.95
68_G	71_A	1.832	0.95
42_D	45_L	1.790	0.94
74_K	80_N	1.757	0.94
42_D	100_D	1.756	0.94
67_P	71_A	1.711	0.93
39_V	43_F	1.706	0.93
61_F	70_P	1.637	0.91
55_A	59_N	1.540	0.88
68_G	72_S	1.519	0.87
53_I	77_D	1.499	0.87
55_A	92_N	1.444	0.85
25_T	28_P	1.442	0.84
67_P	70_P	1.384	0.82
60_V	63_W	1.313	0.78
69_H	72_S	1.282	0.77
64_Y	68_G	1.257	0.75
60_V	83_A	1.255	0.75
47_I	50_G	1.229	0.73
64_Y	67_P	1.214	0.73
86_F	101_V	1.194	0.71
65_D	72_S	1.176	0.70
58_V	85_I	1.166	0.69
67_P	72_S	1.150	0.68
21_K	97_A	1.141	0.68
19_G	23_Y	1.139	0.68
22_V	33_G	1.132	0.67
89_A	93_V	1.121	0.66
40_G	81_E	1.077	0.63
45_L	100_D	1.072	0.63
36_G	43_F	1.042	0.61
25_T	39_V	1.040	0.60
65_D	71_A	1.036	0.60
91_V	101_V	1.025	0.59
62_Q	67_P	1.014	0.58
39_V	75_K	0.957	0.54
64_Y	72_S	0.935	0.52
56_C	94_C	0.931	0.52
90_C	94_C	0.931	0.52
56_C	90_C	0.931	0.52
73_E	80_N	0.908	0.50
43_F	75_K	0.897	0.49
76_A	95_P	0.890	0.49
65_D	68_G	0.885	0.48
20_H	23_Y	0.867	0.47
26_V	47_I	0.844	0.45
32_L	97_A	0.843	0.45
70_P	95_P	0.840	0.45
75_K	85_I	0.828	0.44
65_D	69_H	0.826	0.44
75_K	78_P	0.824	0.44
75_K	97_A	0.822	0.43
44_D	51_S	0.812	0.43
60_V	69_H	0.808	0.42
58_V	61_F	0.795	0.41
30_G	74_K	0.785	0.41
64_Y	71_A	0.782	0.40
55_A	89_A	0.776	0.40
22_V	100_D	0.771	0.39
36_G	58_V	0.764	0.39
31_K	95_P	0.763	0.39
76_A	81_E	0.761	0.39
52_C	90_C	0.749	0.38
52_C	56_C	0.749	0.38
52_C	94_C	0.749	0.38
42_D	102_K	0.741	0.37
19_G	25_T	0.726	0.36
74_K	79_V	0.719	0.36
28_P	74_K	0.693	0.34
88_M	101_V	0.691	0.34
66_T	72_S	0.691	0.34
84_C	87_C	0.690	0.34
60_V	64_Y	0.687	0.33
26_V	37_T	0.684	0.33
44_D	66_T	0.679	0.33
42_D	46_C	0.672	0.32
55_A	58_V	0.669	0.32
43_F	76_A	0.653	0.31
46_C	50_G	0.641	0.30
27_E	47_I	0.640	0.30
80_N	83_A	0.639	0.30
73_E	77_D	0.635	0.30
64_Y	69_H	0.634	0.30
42_D	91_V	0.634	0.30
86_F	97_A	0.632	0.30
24_G	51_S	0.627	0.29
24_G	31_K	0.620	0.29
42_D	92_N	0.618	0.29
30_G	40_G	0.613	0.28
25_T	74_K	0.606	0.28
61_F	67_P	0.606	0.28
83_A	99_I	0.601	0.28
54_N	82_Q	0.594	0.27
24_G	53_I	0.592	0.27
22_V	59_N	0.585	0.27
58_V	95_P	0.581	0.26
49_D	90_C	0.580	0.26
49_D	56_C	0.580	0.26
49_D	94_C	0.580	0.26
24_G	54_N	0.569	0.26
58_V	76_A	0.568	0.26
88_M	93_V	0.558	0.25
62_Q	78_P	0.555	0.25
68_G	73_E	0.552	0.25
23_Y	26_V	0.548	0.24
59_N	86_F	0.543	0.24
82_Q	102_K	0.535	0.24
29_P	38_I	0.535	0.24
56_C	84_C	0.534	0.24
84_C	90_C	0.534	0.24
84_C	94_C	0.534	0.24
28_P	38_I	0.532	0.23
51_S	89_A	0.528	0.23
39_V	96_V	0.519	0.23
74_K	77_D	0.516	0.23
48_A	77_D	0.508	0.22
51_S	96_V	0.500	0.22
48_A	89_A	0.500	0.22

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1xerA	2	0.9808	99.6	0.489	Contact Map
2gmhA	1	0.9615	99.4	0.563	Contact Map
3i9v9	1	0.8077	99.4	0.563	Contact Map
2c42A	2	1	99.4	0.566	Contact Map
3gyxB	1	0.5865	99.3	0.57	Contact Map
1hfeL	2	0.7885	99.3	0.575	Contact Map
3c8yA	1	1	99.3	0.58	Contact Map
1q16B	2	0.9327	99.3	0.581	Contact Map
4omfG	2	0.9135	99.3	0.582	Contact Map
1gteA	4	0.9231	99.3	0.584	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.