TPIS - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TPIS - Triosephosphate isomerase

UniProt:	Q97VM8	Sequences: MKPPIIIINFKAYENSFGDKAVNLGKKIEKISKEYSVEIILSTPATMIYRMSQEVDLPIYAEHVDPVPLGAFTGAILPEMVKDAGAKGTLINHSERRLRADEIDDVLKRTKKLGLKSILCVDRYELVYPFSLLKPDAILIEPPELIGTGVSVSKAKPEVITRAVDEIRKSEGIYLIAGAGITTGEDVYKALKLGAHGIGVASAVMKAKEPEKVVEDFITSALRAISS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	227 (212)
Sequences:	302 (219)
Seq/√Len:	15.0

HALSA - TPIS
SULSO - TPIS

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
7_I	118_I	4.490	1.00
75_A	96_R	4.457	1.00
89_T	117_S	4.041	1.00
81_V	86_A	3.878	1.00
110_T	117_S	3.619	0.99
209_E	212_K	3.344	0.99
44_P	47_M	3.251	0.99
49_Y	53_Q	3.185	0.99
121_V	127_V	3.016	0.98
214_V	218_I	2.639	0.95
44_P	80_M	2.586	0.95
157_P	190_A	2.503	0.94
89_T	110_T	2.481	0.93
64_V	89_T	2.386	0.92
71_A	177_A	2.379	0.92
148_T	182_T	2.343	0.91
91_I	103_I	2.321	0.91
139_L	199_G	2.314	0.91
99_R	102_E	2.257	0.90
79_E	109_R	2.242	0.89
148_T	154_K	2.131	0.87
213_V	216_D	2.131	0.87
149_G	182_T	2.130	0.87
43_T	48_I	2.082	0.85
8_I	214_V	2.044	0.84
138_I	173_I	1.998	0.83
109_R	113_L	1.963	0.82
150_V	155_A	1.944	0.81
48_I	61_A	1.918	0.80
52_S	86_A	1.916	0.80
148_T	151_S	1.884	0.79
45_A	76_I	1.720	0.72
50_R	54_E	1.687	0.70
78_P	109_R	1.663	0.69
35_Y	215_E	1.618	0.67
33_K	56_D	1.614	0.67
149_G	181_I	1.580	0.65
211_E	215_E	1.572	0.65
22_V	51_M	1.543	0.63
140_I	177_A	1.537	0.63
168_R	173_I	1.531	0.63
66_P	102_E	1.506	0.61
149_G	154_K	1.404	0.56
189_K	192_K	1.379	0.54
139_L	176_I	1.378	0.54
44_P	77_L	1.378	0.54
151_S	154_K	1.357	0.53
216_D	219_T	1.331	0.52
168_R	175_L	1.314	0.51
83_D	114_G	1.301	0.50
25_G	55_V	1.300	0.50
160_I	177_A	1.300	0.50
48_I	84_A	1.299	0.50
177_A	195_A	1.280	0.49
8_I	12_A	1.276	0.49
142_P	197_G	1.269	0.48
67_V	77_L	1.253	0.47
90_L	139_L	1.244	0.47
10_F	21_A	1.242	0.47
64_V	77_L	1.224	0.46
111_K	136_D	1.220	0.46
48_I	86_A	1.211	0.45
101_D	123_R	1.199	0.44
148_T	181_I	1.194	0.44
6_I	214_V	1.193	0.44
200_V	214_V	1.184	0.44
134_K	172_G	1.182	0.43
127_V	167_I	1.174	0.43
10_F	25_G	1.157	0.42
97_R	121_V	1.157	0.42
43_T	157_P	1.156	0.42
114_G	209_E	1.155	0.42
183_T	220_S	1.153	0.42
91_I	133_L	1.150	0.42
97_R	101_D	1.144	0.41
38_E	58_P	1.140	0.41
182_T	203_A	1.135	0.41
20_K	214_V	1.127	0.40
193_L	197_G	1.106	0.39
151_S	181_I	1.099	0.39
68_P	112_K	1.093	0.39
100_A	130_F	1.085	0.38
154_K	181_I	1.085	0.38
63_H	142_P	1.084	0.38
41_L	76_I	1.075	0.38
57_L	134_K	1.074	0.38
6_I	198_I	1.073	0.38
96_R	218_I	1.072	0.37
117_S	148_T	1.063	0.37
184_G	216_D	1.057	0.37
30_K	211_E	1.049	0.36
69_L	77_L	1.041	0.36
133_L	218_I	1.040	0.36
56_D	91_I	1.040	0.36
12_A	17_F	1.032	0.35
152_V	193_L	1.023	0.35
22_V	55_V	1.018	0.35
22_V	25_G	1.016	0.35
131_S	173_I	0.999	0.34
188_Y	192_K	0.989	0.33
104_D	188_Y	0.987	0.33
151_S	155_A	0.986	0.33
94_S	139_L	0.975	0.33
160_I	175_L	0.970	0.32
151_S	189_K	0.970	0.32
107_L	208_K	0.962	0.32
107_L	119_L	0.960	0.32
19_D	83_D	0.955	0.32
40_I	60_Y	0.953	0.31
108_K	125_E	0.952	0.31
40_I	88_G	0.950	0.31
101_D	122_D	0.945	0.31
81_V	115_L	0.937	0.31
116_K	136_D	0.934	0.31
12_A	80_M	0.932	0.30
30_K	33_K	0.927	0.30
68_P	77_L	0.923	0.30
154_K	185_E	0.922	0.30
131_S	176_I	0.914	0.30
152_V	157_P	0.908	0.29
76_I	127_V	0.903	0.29
71_A	203_A	0.897	0.29
94_S	201_A	0.891	0.29
12_A	44_P	0.885	0.28
73_T	152_V	0.883	0.28
149_G	153_S	0.880	0.28
122_D	129_P	0.878	0.28
129_P	175_L	0.877	0.28
59_I	65_D	0.870	0.28
31_I	97_R	0.869	0.28
32_S	55_V	0.866	0.27
19_D	117_S	0.865	0.27
41_L	106_V	0.863	0.27
200_V	218_I	0.858	0.27
134_K	165_D	0.845	0.26
81_V	117_S	0.835	0.26
120_C	146_I	0.831	0.26
78_P	113_L	0.830	0.26
104_D	134_K	0.830	0.26
143_P	178_G	0.829	0.26
44_P	191_L	0.827	0.26
119_L	130_F	0.824	0.26
142_P	152_V	0.822	0.25
73_T	94_S	0.820	0.25
69_L	76_I	0.817	0.25
131_S	167_I	0.817	0.25
205_M	209_E	0.815	0.25
26_K	134_K	0.815	0.25
10_F	55_V	0.815	0.25
20_K	23_N	0.814	0.25
22_V	50_R	0.812	0.25
22_V	26_K	0.809	0.25
157_P	193_L	0.807	0.25
167_I	181_I	0.805	0.25
148_T	183_T	0.805	0.25
47_M	127_V	0.803	0.25
72_F	77_L	0.800	0.25
26_K	109_R	0.800	0.25
152_V	159_V	0.798	0.24
94_S	143_P	0.792	0.24
16_S	117_S	0.789	0.24
22_V	186_D	0.789	0.24
102_E	172_G	0.781	0.24
37_V	64_V	0.781	0.24
73_T	157_P	0.781	0.24
53_Q	159_V	0.773	0.23
97_R	103_I	0.772	0.23
107_L	130_F	0.769	0.23
8_I	91_I	0.767	0.23
139_L	200_V	0.765	0.23
38_E	44_P	0.754	0.23
38_E	192_K	0.751	0.23
143_P	201_A	0.750	0.23
8_I	28_I	0.750	0.23
100_A	129_P	0.749	0.22
64_V	81_V	0.749	0.22
143_P	157_P	0.748	0.22
6_I	161_T	0.748	0.22
50_R	216_D	0.748	0.22
127_V	163_A	0.747	0.22
7_I	176_I	0.745	0.22
8_I	200_V	0.743	0.22
107_L	117_S	0.731	0.22
76_I	91_I	0.729	0.22
52_S	110_T	0.727	0.22
17_F	44_P	0.726	0.22
104_D	126_L	0.717	0.21
94_S	97_R	0.715	0.21
34_E	215_E	0.715	0.21
18_G	21_A	0.714	0.21
120_C	199_G	0.712	0.21
208_K	211_E	0.711	0.21
88_G	143_P	0.706	0.21
12_A	188_Y	0.705	0.21
142_P	193_L	0.704	0.21
45_A	209_E	0.701	0.21
213_V	218_I	0.700	0.21
66_P	161_T	0.697	0.21
36_S	39_I	0.696	0.20
73_T	142_P	0.695	0.20
163_A	195_A	0.694	0.20
68_P	108_K	0.694	0.20
18_G	24_L	0.693	0.20
130_F	173_I	0.686	0.20
140_I	190_A	0.680	0.20
6_I	216_D	0.677	0.20
51_M	59_I	0.675	0.20
51_M	82_K	0.671	0.20
34_E	216_D	0.670	0.20
136_D	182_T	0.664	0.19
24_L	214_V	0.660	0.19
65_D	96_R	0.659	0.19
61_A	84_A	0.654	0.19
5_I	10_F	0.653	0.19
10_F	110_T	0.651	0.19
210_P	214_V	0.651	0.19
188_Y	220_S	0.651	0.19
124_Y	137_A	0.649	0.19
53_Q	173_I	0.647	0.19
64_V	90_L	0.646	0.19
134_K	188_Y	0.644	0.19
88_G	97_R	0.644	0.19
63_H	96_R	0.643	0.19
68_P	107_L	0.642	0.19
106_V	215_E	0.637	0.18
39_I	168_R	0.637	0.18
83_D	105_D	0.635	0.18
145_L	179_A	0.634	0.18
65_D	176_I	0.626	0.18
111_K	171_E	0.624	0.18
16_S	88_G	0.623	0.18
41_L	57_L	0.623	0.18
23_N	26_K	0.622	0.18
73_T	143_P	0.619	0.18
31_I	35_Y	0.618	0.18
171_E	175_L	0.618	0.18
160_I	189_K	0.616	0.18
126_L	130_F	0.614	0.18
35_Y	39_I	0.614	0.18
145_L	197_G	0.610	0.18
129_P	132_L	0.608	0.17
174_Y	197_G	0.608	0.17
152_V	179_A	0.605	0.17
19_D	107_L	0.605	0.17
36_S	193_L	0.605	0.17
30_K	111_K	0.604	0.17
132_L	195_A	0.600	0.17
105_D	108_K	0.599	0.17
73_T	90_L	0.598	0.17
20_K	109_R	0.593	0.17
151_S	213_V	0.591	0.17
203_A	213_V	0.590	0.17
84_A	96_R	0.586	0.17
26_K	56_D	0.586	0.17
72_F	198_I	0.585	0.17
89_T	164_V	0.583	0.17
157_P	201_A	0.577	0.16
101_D	105_D	0.577	0.16
142_P	147_G	0.574	0.16
27_K	129_P	0.573	0.16
173_I	206_K	0.573	0.16
153_S	181_I	0.573	0.16
30_K	172_G	0.568	0.16
130_F	138_I	0.568	0.16
42_S	48_I	0.567	0.16
48_I	205_M	0.567	0.16
33_K	209_E	0.566	0.16
31_I	112_K	0.565	0.16
64_V	110_T	0.563	0.16
47_M	77_L	0.561	0.16
33_K	117_S	0.559	0.16
30_K	82_K	0.554	0.16
76_I	96_R	0.553	0.16
67_V	136_D	0.552	0.16
21_A	24_L	0.551	0.16
51_M	55_V	0.550	0.16
140_I	159_V	0.549	0.16
19_D	50_R	0.549	0.16
114_G	183_T	0.546	0.16
112_K	136_D	0.546	0.16
195_A	207_A	0.545	0.16
68_P	72_F	0.545	0.16
111_K	191_L	0.544	0.15
121_V	126_L	0.544	0.15
134_K	168_R	0.541	0.15
35_Y	216_D	0.540	0.15
43_T	73_T	0.540	0.15
153_S	185_E	0.539	0.15
30_K	212_K	0.534	0.15
26_K	212_K	0.534	0.15
164_V	211_E	0.533	0.15
79_E	165_D	0.533	0.15
85_G	171_E	0.532	0.15
79_E	113_L	0.531	0.15
9_N	197_G	0.530	0.15
60_Y	88_G	0.529	0.15
5_I	55_V	0.527	0.15
105_D	109_R	0.525	0.15
63_H	98_L	0.523	0.15
187_V	219_T	0.523	0.15
101_D	126_L	0.521	0.15
113_L	134_K	0.521	0.15
81_V	196_H	0.520	0.15
45_A	196_H	0.518	0.15
64_V	78_P	0.517	0.15
142_P	145_L	0.516	0.15
80_M	195_A	0.516	0.15
106_V	195_A	0.511	0.15
178_G	200_V	0.511	0.15
24_L	207_A	0.511	0.15
22_V	53_Q	0.507	0.14
66_P	195_A	0.507	0.14
155_A	198_I	0.506	0.14
9_N	193_L	0.503	0.14
42_S	143_P	0.502	0.14
106_V	113_L	0.501	0.14
61_A	174_Y	0.501	0.14
12_A	213_V	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4y9aA	2	0.9383	100	0.513	Contact Map
4y96A	2	0.9515	100	0.515	Contact Map
4y8fA	2	0.9295	100	0.524	Contact Map
4y90A	3	0.9339	100	0.526	Contact Map
2h6rA	3	0.9207	100	0.54	Contact Map
4g1kA	2	0.9383	100	0.55	Contact Map
1hg3A	3	0.9736	100	0.557	Contact Map
4mvaA	2	0.9515	100	0.563	Contact Map
1mo0A	2	0.9559	100	0.566	Contact Map
3kxqA	2	0.9075	100	0.567	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0079 seconds.