Q97VL9 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97VL9 - Small heat shock protein hsp20 family

UniProt:	Q97VL9	Sequences: MMNVIMREIGKKLDELSREFYESVIPPIDMYEEGGELVVVADLAGFNKDKISVRLSAQNELIINAEREIQYIGTKYATQRPLKIHKVIRLPVKVKRDSQVTAKYENGVLTIRIPVEGSVSIRIE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	124 (109)
Sequences:	5402 (4210)
Seq/√Len:	403.2

BACSU - COTP YOCM
HALSA - Q9HP50 Q9HHW1 Q9HSS6
SULSO - Q97VL9 Q97W19

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
95_K	98_S	4.014	1.00
36_E	112_R	3.060	1.00
33_E	36_E	2.707	1.00
41_A	63_I	2.683	1.00
28_I	88_I	2.306	1.00
47_N	106_N	2.213	1.00
32_E	115_V	2.190	1.00
28_I	41_A	2.108	1.00
40_V	110_T	2.053	1.00
66_E	83_K	2.034	1.00
64_N	85_H	2.001	1.00
42_D	108_V	1.967	1.00
51_I	104_Y	1.957	1.00
47_N	50_K	1.947	1.00
33_E	38_V	1.936	1.00
94_V	113_I	1.909	1.00
60_E	87_V	1.693	1.00
38_V	110_T	1.674	1.00
43_L	51_I	1.650	1.00
52_S	64_N	1.631	1.00
29_D	80_R	1.580	1.00
31_Y	38_V	1.573	1.00
95_K	116_E	1.571	1.00
60_E	89_R	1.568	1.00
43_L	104_Y	1.562	1.00
65_A	84_I	1.531	1.00
29_D	78_T	1.506	1.00
55_L	90_L	1.504	1.00
98_S	101_T	1.503	1.00
46_F	65_A	1.495	1.00
42_D	80_R	1.478	1.00
64_N	83_K	1.461	1.00
62_I	87_V	1.407	1.00
31_Y	40_V	1.387	1.00
117_G	120_S	1.355	1.00
39_V	113_I	1.312	1.00
79_Q	86_K	1.292	1.00
98_S	114_P	1.265	1.00
26_P	84_I	1.243	1.00
48_K	52_S	1.180	1.00
29_D	40_V	1.162	1.00
47_N	105_E	1.152	1.00
50_K	68_E	1.128	1.00
48_K	106_N	1.111	1.00
12_K	16_L	1.103	1.00
73_G	76_Y	1.076	1.00
54_R	62_I	1.062	1.00
50_K	67_R	1.056	1.00
103_K	110_T	1.053	1.00
35_G	120_S	1.046	1.00
53_V	111_I	1.031	1.00
59_N	96_R	1.028	1.00
55_L	100_V	1.026	1.00
61_L	111_I	1.014	1.00
11_K	14_D	0.996	1.00
69_I	78_T	0.987	1.00
74_T	77_A	0.968	1.00
37_L	93_K	0.948	1.00
65_A	82_L	0.946	1.00
53_V	102_A	0.942	1.00
29_D	42_D	0.936	1.00
90_L	113_I	0.931	1.00
38_V	112_R	0.922	1.00
26_P	41_A	0.921	1.00
105_E	110_T	0.907	1.00
43_L	46_F	0.902	1.00
26_P	43_L	0.895	1.00
42_D	67_R	0.892	1.00
56_S	60_E	0.889	1.00
96_R	114_P	0.878	1.00
61_L	100_V	0.876	1.00
103_K	112_R	0.873	1.00
51_I	80_R	0.858	1.00
93_K	116_E	0.850	1.00
37_L	92_V	0.849	1.00
39_V	88_I	0.849	1.00
28_I	63_I	0.849	1.00
18_R	21_Y	0.835	1.00
55_L	96_R	0.832	1.00
11_K	15_E	0.826	1.00
46_F	67_R	0.825	1.00
17_S	20_F	0.824	1.00
101_T	112_R	0.824	1.00
11_K	16_L	0.820	1.00
93_K	115_V	0.814	1.00
66_E	81_P	0.809	1.00
24_V	65_A	0.807	1.00
30_M	39_V	0.805	1.00
30_M	37_L	0.804	1.00
43_L	65_A	0.803	1.00
46_F	51_I	0.786	1.00
26_P	65_A	0.784	1.00
40_V	108_V	0.776	1.00
68_E	81_P	0.775	1.00
32_E	48_K	0.769	1.00
29_D	81_P	0.763	1.00
43_L	84_I	0.759	1.00
31_Y	37_L	0.746	1.00
27_P	42_D	0.740	1.00
91_P	94_V	0.731	1.00
17_S	21_Y	0.727	1.00
31_Y	73_G	0.726	1.00
72_I	78_T	0.719	1.00
67_R	82_L	0.711	1.00
62_I	85_H	0.699	1.00
12_K	15_E	0.693	1.00
69_I	81_P	0.691	1.00
102_A	111_I	0.690	1.00
36_E	115_V	0.677	0.99
46_F	50_K	0.675	0.99
59_N	92_V	0.675	0.99
47_N	104_Y	0.671	0.99
15_E	18_R	0.666	0.99
37_L	100_V	0.655	0.99
54_R	64_N	0.648	0.99
29_D	43_L	0.637	0.99
41_A	88_I	0.624	0.99
84_I	100_V	0.620	0.99
72_I	75_K	0.608	0.99
67_R	81_P	0.602	0.99
52_S	66_E	0.602	0.99
14_D	17_S	0.601	0.99
16_L	19_E	0.594	0.99
12_K	18_R	0.585	0.98
116_E	119_V	0.582	0.98
73_G	77_A	0.581	0.98
51_I	111_I	0.579	0.98
41_A	53_V	0.575	0.98
55_L	94_V	0.575	0.98
25_I	29_D	0.572	0.98
48_K	104_Y	0.567	0.98
87_V	91_P	0.561	0.98
92_V	116_E	0.560	0.98
56_S	62_I	0.558	0.98
40_V	45_G	0.558	0.98
13_L	18_R	0.554	0.98
31_Y	76_Y	0.553	0.98
71_Y	75_K	0.551	0.98
27_P	62_I	0.548	0.98
48_K	115_V	0.548	0.98
65_A	91_P	0.544	0.98
26_P	79_Q	0.543	0.98
26_P	91_P	0.539	0.97
55_L	61_L	0.539	0.97
58_Q	93_K	0.537	0.97
17_S	22_E	0.536	0.97
42_D	81_P	0.534	0.97
80_R	100_V	0.529	0.97
79_Q	88_I	0.528	0.97
35_G	115_V	0.526	0.97
79_Q	82_L	0.525	0.97
101_T	110_T	0.522	0.97
46_F	82_L	0.517	0.97
78_T	81_P	0.517	0.97
100_V	114_P	0.516	0.97
39_V	67_R	0.516	0.97
70_Q	81_P	0.511	0.96
13_L	16_L	0.511	0.96
59_N	89_R	0.508	0.96
24_V	82_L	0.507	0.96
38_V	41_A	0.503	0.96
80_R	108_V	0.502	0.96
20_F	23_S	0.501	0.96
46_F	102_A	0.500	0.96

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4eldA	4	0.8306	100	0.253	Contact Map
3aabA	2	0.9032	100	0.257	Contact Map
3w1zA	7	0.9839	100	0.279	Contact Map
2bolA	2	0.9516	99.9	0.322	Contact Map
1gmeA	6	0.9839	99.9	0.33	Contact Map
3glaA	2	0.7742	99.9	0.335	Contact Map
4jutA	4	0.7177	99.9	0.362	Contact Map
4ydzA	4	0.9113	99.9	0.363	Contact Map
4feiA	2	0.8065	99.9	0.368	Contact Map
4ye0A	2	0.7581	99.9	0.383	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.