Q97VL0 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97VL0 - Peroxiredoxin, bacterioferritin comigratory protein homolog (Bcp-4)

UniProt:	Q97VL0	Sequences: MVEIGEKAPEIELVDTDLKKVKIPSDFKGKVVVLAFYPAAFTSVCTKEMCTFRDSMAKFNEVNAVVIGISVDPPFSNKAFKEQNKINFTIVSDFNREAVKAYGVAGELPILKGYVLAKRSVFVIDKNGIVRYKWVSEDPTKEPNYDEIKDVVTKLS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	156 (142)
Sequences:	12891 (7974)
Seq/√Len:	669.2

ECOLI - AHPC TPX BCP DSBE
BACSU - AHPC BCP YKUU TPX YKUV RESA STOA YNEN
HALSA - Q9HQE6 Q9HP28 Q9HN00 Q9HRG4
SULSO - Q97VL0 Q97WG5 Q97WP9 TDXH

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
31_V	126_K	3.402	1.00
12_E	20_K	2.940	1.00
30_K	65_V	2.837	1.00
53_R	87_N	2.593	1.00
15_D	19_K	2.549	1.00
40_A	77_N	2.528	1.00
8_A	102_Y	2.517	1.00
12_E	22_K	2.460	1.00
125_D	131_R	2.329	1.00
7_K	129_I	2.256	1.00
56_M	60_N	2.236	1.00
14_V	20_K	2.209	1.00
55_S	58_K	2.020	1.00
106_G	118_K	1.983	1.00
125_D	129_I	1.898	1.00
3_E	6_E	1.876	1.00
10_E	22_K	1.846	1.00
15_D	21_V	1.811	1.00
27_F	32_V	1.773	1.00
97_E	101_A	1.763	1.00
22_K	25_S	1.751	1.00
16_T	81_K	1.728	1.00
56_M	87_N	1.675	1.00
71_V	96_R	1.614	1.00
132_Y	151_V	1.606	1.00
99_V	117_A	1.595	1.00
13_L	91_V	1.574	1.00
71_V	99_V	1.523	1.00
13_L	98_A	1.504	1.00
49_M	86_I	1.500	1.00
55_S	145_Y	1.497	1.00
51_T	55_S	1.495	1.00
21_V	27_F	1.492	1.00
32_V	128_G	1.393	1.00
64_A	152_V	1.373	1.00
15_D	89_T	1.368	1.00
22_K	26_D	1.366	1.00
26_D	29_G	1.365	1.00
41_F	84_N	1.363	1.00
33_V	123_V	1.351	1.00
60_N	65_V	1.326	1.00
41_F	79_A	1.321	1.00
8_A	124_I	1.309	1.00
32_V	65_V	1.298	1.00
71_V	117_A	1.287	1.00
78_K	82_E	1.274	1.00
146_D	150_D	1.263	1.00
31_V	131_R	1.230	1.00
10_E	25_S	1.211	1.00
124_I	130_V	1.201	1.00
55_S	146_D	1.194	1.00
32_V	67_I	1.178	1.00
53_R	88_F	1.161	1.00
31_V	64_A	1.149	1.00
50_C	54_D	1.135	1.00
27_F	67_I	1.129	1.00
57_A	60_N	1.125	1.00
96_R	100_K	1.112	1.00
35_A	49_M	1.109	1.00
58_K	61_E	1.106	1.00
134_W	151_V	1.082	1.00
147_E	150_D	1.078	1.00
96_R	105_A	1.073	1.00
51_T	54_D	1.067	1.00
36_F	69_I	1.065	1.00
68_G	90_I	1.059	1.00
4_I	132_Y	1.050	1.00
104_V	120_S	1.038	1.00
14_V	74_P	1.016	1.00
15_D	91_V	1.008	1.00
58_K	149_K	1.005	1.00
41_F	83_Q	1.004	1.00
65_V	89_T	0.999	1.00
100_K	115_V	0.991	1.00
10_E	23_I	0.979	1.00
57_A	61_E	0.977	1.00
100_K	105_A	0.968	1.00
107_E	115_V	0.967	1.00
131_R	137_E	0.962	1.00
50_C	53_R	0.958	1.00
46_T	84_N	0.958	1.00
75_F	79_A	0.951	1.00
33_V	121_V	0.949	1.00
98_A	102_Y	0.943	1.00
25_S	28_K	0.936	1.00
73_P	76_S	0.934	1.00
104_V	122_F	0.932	1.00
120_S	135_V	0.931	1.00
52_F	66_V	0.919	1.00
32_V	124_I	0.917	1.00
41_F	76_S	0.915	1.00
79_A	82_E	0.912	1.00
63_N	126_K	0.910	1.00
34_L	124_I	0.905	1.00
67_I	91_V	0.900	1.00
118_K	135_V	0.892	1.00
123_V	151_V	0.883	1.00
78_K	81_K	0.876	1.00
23_I	32_V	0.875	1.00
17_D	78_K	0.874	1.00
97_E	100_K	0.874	1.00
11_I	98_A	0.861	1.00
35_A	88_F	0.856	1.00
74_P	92_S	0.851	1.00
28_K	128_G	0.849	1.00
8_A	130_V	0.847	1.00
122_F	130_V	0.847	1.00
11_I	102_Y	0.847	1.00
123_V	132_Y	0.835	1.00
62_V	152_V	0.822	1.00
108_L	116_L	0.811	1.00
33_V	64_A	0.811	1.00
93_D	96_R	0.810	1.00
99_V	105_A	0.809	1.00
118_K	136_S	0.799	1.00
47_K	50_C	0.794	1.00
50_C	84_N	0.792	1.00
96_R	99_V	0.791	1.00
31_V	63_N	0.777	1.00
4_I	133_K	0.775	1.00
21_V	67_I	0.772	1.00
80_F	84_N	0.770	1.00
53_R	57_A	0.766	1.00
31_V	152_V	0.759	1.00
105_A	115_V	0.753	1.00
143_P	146_D	0.753	1.00
39_A	72_D	0.747	1.00
108_L	114_Y	0.738	1.00
14_V	94_F	0.730	1.00
48_E	121_V	0.728	1.00
8_A	23_I	0.726	1.00
36_F	104_V	0.725	1.00
37_Y	68_G	0.723	1.00
49_M	68_G	0.721	1.00
37_Y	40_A	0.712	1.00
16_T	78_K	0.708	1.00
124_I	128_G	0.700	1.00
53_R	56_M	0.699	1.00
57_A	87_N	0.694	1.00
4_I	130_V	0.685	1.00
21_V	26_D	0.680	1.00
75_F	78_K	0.678	1.00
69_I	98_A	0.676	1.00
77_N	80_F	0.675	1.00
52_F	148_I	0.674	1.00
134_W	147_E	0.672	1.00
120_S	133_K	0.671	1.00
123_V	134_W	0.667	1.00
7_K	28_K	0.664	1.00
143_P	147_E	0.664	1.00
39_A	116_L	0.664	1.00
17_D	81_K	0.659	1.00
134_W	148_I	0.658	1.00
23_I	27_F	0.651	1.00
33_V	52_F	0.648	1.00
81_K	90_I	0.641	1.00
56_M	65_V	0.639	1.00
8_A	98_A	0.639	1.00
35_A	48_E	0.637	1.00
132_Y	147_E	0.635	1.00
122_F	133_K	0.634	1.00
31_V	123_V	0.633	1.00
29_G	126_K	0.625	1.00
48_E	52_F	0.624	1.00
59_F	149_K	0.621	1.00
51_T	145_Y	0.618	1.00
121_V	148_I	0.617	1.00
73_P	94_F	0.616	1.00
16_T	89_T	0.614	1.00
38_P	42_T	0.614	1.00
144_N	147_E	0.614	1.00
62_V	149_K	0.612	1.00
34_L	102_Y	0.611	1.00
3_E	133_K	0.611	1.00
42_T	119_R	0.607	1.00
36_F	98_A	0.599	1.00
28_K	127_N	0.589	1.00
58_K	62_V	0.582	1.00
27_F	65_V	0.576	1.00
11_I	23_I	0.575	1.00
72_D	76_S	0.573	1.00
7_K	10_E	0.569	1.00
47_K	51_T	0.569	1.00
74_P	78_K	0.569	1.00
43_S	47_K	0.565	1.00
98_A	101_A	0.557	1.00
6_E	133_K	0.555	1.00
35_A	121_V	0.555	1.00
40_A	76_S	0.555	1.00
9_P	101_A	0.553	1.00
59_F	64_A	0.552	1.00
99_V	104_V	0.551	1.00
106_G	114_Y	0.549	1.00
10_E	28_K	0.546	1.00
39_A	42_T	0.546	1.00
33_V	148_I	0.545	1.00
76_S	79_A	0.539	1.00
51_T	140_T	0.539	1.00
52_F	145_Y	0.538	1.00
114_Y	118_K	0.534	1.00
26_D	67_I	0.533	1.00
36_F	102_Y	0.533	1.00
55_S	59_F	0.532	1.00
47_K	140_T	0.532	1.00
116_L	138_D	0.532	1.00
94_F	115_V	0.524	0.99
106_G	116_L	0.519	0.99
35_A	68_G	0.517	0.99
33_V	152_V	0.513	0.99
79_A	83_Q	0.511	0.99
66_V	88_F	0.506	0.99
59_F	63_N	0.502	0.99
43_S	46_T	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3w6gA	6	0.9487	100	0.252	Contact Map
3a2vA	5	0.9615	100	0.259	Contact Map
2v2gA	2	0.9744	100	0.26	Contact Map
1xiyA	1	0.9808	100	0.273	Contact Map
1prxA	2	0.9744	100	0.275	Contact Map
1xccA	2	0.9808	100	0.28	Contact Map
1xvwA	3	0.9551	100	0.289	Contact Map
4g2eA	2	0.9551	100	0.308	Contact Map
2c0dA	2	0.9359	100	0.31	Contact Map
3tjjA	3	0.9551	100	0.311	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.