Q97VK0 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97VK0 - Enoyl CoA hydratase (PaaF-7)

UniProt:	Q97VK0	Sequences: MQVNYIYMYSTIQIEVIDNIGIIKLNRPDKLNAINFQMVDELVDVLNKLDNDDKIKVVIITGNGKAFSAGADVKEMLETPLEEIMKKGHMPLWEKLRTFKKPVIAALNGITAGGGLELAMACDIIIASESAKLGQPEINLGIMPGAGGTQRLTRVLGKYKAMELVLTGKLIDSKEAERYGLVNKVVPDNSLIDEAIRLAREIAEKPIISIILAKEAVARAWDTLLQQGLDFERRNFYLALNTKEAKEGMRAFLEKRKPRWENDKSR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	266 (247)
Sequences:	30114 (19710)
Seq/√Len:	1254.1

ECOLI - PAAG MENB PAAF CAID SCPB FADB FADJ
BACSU - MENB FADB YNGF PKSH YHAR PKSI FADN
HALSA - Q9HQN4 Q9HS32 Q9HQ61
SULSO - Q97VK0 Q97WU7 Q97YL2 Q7LXQ1 Q97VK1 Q97VU5 Q97VS6 Q980Z9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
132_K	170_L	3.097	1.00
129_E	187_P	2.992	1.00
184_K	194_E	2.905	1.00
127_A	182_V	2.871	1.00
105_A	122_C	2.758	1.00
194_E	197_R	2.609	1.00
22_I	196_I	2.571	1.00
47_N	95_K	2.429	1.00
50_D	100_K	2.401	1.00
169_K	201_E	2.229	1.00
16_V	21_G	2.219	1.00
175_E	178_R	2.141	1.00
31_L	65_K	2.102	1.00
13_Q	26_N	2.094	1.00
130_S	188_D	2.074	1.00
22_I	61_T	2.050	1.00
224_L	227_Q	2.025	1.00
172_D	175_E	2.021	1.00
129_E	174_K	1.966	1.00
163_E	169_K	1.960	1.00
31_L	66_A	1.938	1.00
19_N	56_K	1.938	1.00
160_K	179_Y	1.937	1.00
43_V	95_K	1.929	1.00
139_N	205_K	1.911	1.00
106_A	195_A	1.906	1.00
24_K	63_N	1.905	1.00
165_V	213_A	1.898	1.00
16_V	52_D	1.891	1.00
14_I	21_G	1.857	1.00
106_A	192_I	1.843	1.00
250_R	254_E	1.841	1.00
24_K	61_T	1.824	1.00
26_N	63_N	1.824	1.00
196_I	200_R	1.765	1.00
112_A	134_G	1.739	1.00
126_I	186_V	1.722	1.00
48_K	52_D	1.715	1.00
37_Q	41_E	1.706	1.00
162_M	218_A	1.702	1.00
21_G	49_L	1.683	1.00
190_S	193_D	1.645	1.00
158_K	162_M	1.635	1.00
247_E	256_R	1.623	1.00
21_G	55_I	1.616	1.00
163_E	183_N	1.600	1.00
175_E	179_Y	1.588	1.00
11_T	41_E	1.585	1.00
190_S	194_E	1.573	1.00
58_V	99_F	1.565	1.00
11_T	35_N	1.532	1.00
126_I	198_L	1.525	1.00
127_A	133_L	1.522	1.00
163_E	184_K	1.514	1.00
129_E	188_D	1.503	1.00
40_D	88_G	1.502	1.00
174_K	178_R	1.501	1.00
50_D	95_K	1.494	1.00
186_V	194_E	1.488	1.00
49_L	58_V	1.479	1.00
94_E	98_T	1.470	1.00
123_D	214_K	1.466	1.00
17_I	196_I	1.455	1.00
23_I	45_V	1.441	1.00
125_I	159_Y	1.431	1.00
107_L	119_A	1.429	1.00
13_Q	63_N	1.407	1.00
162_M	166_L	1.398	1.00
43_V	47_N	1.385	1.00
94_E	226_Q	1.377	1.00
119_A	125_I	1.371	1.00
212_L	238_L	1.369	1.00
18_D	200_R	1.365	1.00
128_S	188_D	1.365	1.00
125_I	155_V	1.350	1.00
108_N	128_S	1.339	1.00
177_E	185_V	1.336	1.00
14_I	49_L	1.334	1.00
108_N	130_S	1.324	1.00
46_L	99_F	1.319	1.00
160_K	163_E	1.306	1.00
162_M	217_V	1.300	1.00
164_L	171_I	1.285	1.00
116_L	135_Q	1.278	1.00
169_K	175_E	1.277	1.00
96_L	103_V	1.274	1.00
107_L	111_T	1.273	1.00
22_I	192_I	1.272	1.00
57_V	199_A	1.267	1.00
17_I	22_I	1.264	1.00
97_R	151_R	1.248	1.00
66_A	110_I	1.248	1.00
17_I	200_R	1.242	1.00
61_T	192_I	1.240	1.00
110_I	132_K	1.233	1.00
61_T	108_N	1.233	1.00
43_V	91_P	1.226	1.00
27_R	30_K	1.223	1.00
36_F	75_E	1.220	1.00
50_D	99_F	1.212	1.00
192_I	196_I	1.199	1.00
223_T	227_Q	1.196	1.00
15_E	24_K	1.193	1.00
134_G	170_L	1.193	1.00
159_Y	183_N	1.187	1.00
215_E	219_R	1.174	1.00
160_K	175_E	1.169	1.00
16_V	54_K	1.169	1.00
65_K	108_N	1.157	1.00
35_N	38_M	1.152	1.00
41_E	45_V	1.144	1.00
25_L	38_M	1.143	1.00
30_K	74_K	1.132	1.00
223_T	231_F	1.130	1.00
192_I	195_A	1.122	1.00
219_R	231_F	1.120	1.00
13_Q	24_K	1.107	1.00
205_K	210_I	1.105	1.00
15_E	22_I	1.103	1.00
245_A	249_M	1.097	1.00
171_I	179_Y	1.096	1.00
98_T	226_Q	1.088	1.00
36_F	40_D	1.088	1.00
191_L	195_A	1.082	1.00
128_S	191_L	1.081	1.00
173_S	185_V	1.077	1.00
11_T	37_Q	1.075	1.00
16_V	48_K	1.070	1.00
157_G	160_K	1.066	1.00
138_I	168_G	1.053	1.00
41_E	44_D	1.042	1.00
58_V	101_K	1.020	1.00
25_L	68_S	1.019	1.00
45_V	48_K	1.018	1.00
199_A	203_A	1.015	1.00
61_T	106_A	1.014	1.00
117_E	148_G	1.012	1.00
156_L	160_K	1.009	1.00
103_V	122_C	0.997	1.00
58_V	103_V	0.992	1.00
155_V	159_Y	0.991	1.00
124_I	198_L	0.983	1.00
89_H	146_A	0.982	1.00
100_K	211_I	0.977	1.00
174_K	177_E	0.975	1.00
193_D	197_R	0.972	1.00
44_D	48_K	0.971	1.00
129_E	185_V	0.970	1.00
187_P	190_S	0.969	1.00
208_I	244_E	0.969	1.00
246_K	250_R	0.956	1.00
68_S	115_G	0.955	1.00
106_A	191_L	0.936	1.00
20_I	57_V	0.931	1.00
116_L	133_L	0.931	1.00
212_L	215_E	0.929	1.00
215_E	235_N	0.927	1.00
59_I	195_A	0.926	1.00
158_K	221_W	0.921	1.00
55_I	101_K	0.907	1.00
177_E	182_V	0.905	1.00
27_R	72_D	0.904	1.00
227_Q	230_D	0.896	1.00
132_K	172_D	0.890	1.00
212_L	235_N	0.886	1.00
207_I	211_I	0.876	1.00
138_I	213_A	0.872	1.00
196_I	199_A	0.870	1.00
231_F	234_R	0.867	1.00
39_V	92_L	0.866	1.00
64_G	108_N	0.858	1.00
107_L	133_L	0.853	1.00
22_I	59_I	0.845	1.00
143_M	239_A	0.843	1.00
197_R	201_E	0.842	1.00
31_L	69_A	0.840	1.00
43_V	88_G	0.838	1.00
195_A	199_A	0.837	1.00
47_N	51_N	0.830	1.00
112_A	170_L	0.829	1.00
80_P	83_E	0.826	1.00
150_Q	228_G	0.826	1.00
23_I	58_V	0.825	1.00
177_E	184_K	0.823	1.00
164_L	179_Y	0.821	1.00
108_N	191_L	0.816	1.00
165_V	217_V	0.813	1.00
128_S	189_N	0.811	1.00
163_E	167_T	0.811	1.00
74_K	253_L	0.805	1.00
16_V	55_I	0.802	1.00
46_L	96_L	0.800	1.00
212_L	239_A	0.790	1.00
152_L	156_L	0.788	1.00
124_I	183_N	0.785	1.00
36_F	88_G	0.783	1.00
219_R	223_T	0.779	1.00
107_L	125_I	0.779	1.00
231_F	235_N	0.778	1.00
149_T	232_E	0.777	1.00
193_D	196_I	0.776	1.00
204_E	257_K	0.774	1.00
184_K	198_L	0.771	1.00
40_D	44_D	0.766	1.00
12_I	45_V	0.766	1.00
53_D	101_K	0.764	1.00
225_L	229_L	0.763	1.00
50_D	101_K	0.762	1.00
173_S	182_V	0.761	1.00
156_L	164_L	0.760	1.00
139_N	170_L	0.759	1.00
11_T	38_M	0.758	1.00
235_N	238_L	0.757	1.00
202_I	210_I	0.749	1.00
243_K	246_K	0.747	1.00
14_I	45_V	0.742	1.00
150_Q	153_T	0.740	1.00
47_N	91_P	0.739	1.00
201_E	205_K	0.738	1.00
60_I	122_C	0.737	1.00
93_W	121_A	0.737	1.00
194_E	198_L	0.735	1.00
49_L	55_I	0.732	1.00
216_A	235_N	0.727	1.00
120_M	181_L	0.722	1.00
126_I	184_K	0.721	1.00
176_A	181_L	0.720	1.00
100_K	215_E	0.720	1.00
66_A	108_N	0.719	1.00
27_R	35_N	0.717	1.00
197_R	200_R	0.716	1.00
43_V	92_L	0.716	1.00
158_K	218_A	0.711	1.00
52_D	55_I	0.710	1.00
56_K	207_I	0.710	1.00
233_R	237_Y	0.708	1.00
200_R	204_E	0.706	1.00
34_I	38_M	0.706	1.00
87_K	233_R	0.702	1.00
157_G	161_A	0.701	1.00
31_L	110_I	0.700	1.00
99_F	103_V	0.686	1.00
84_I	88_G	0.685	1.00
206_P	244_E	0.683	1.00
87_K	91_P	0.677	1.00
198_L	201_E	0.677	1.00
249_M	253_L	0.676	1.00
107_L	131_A	0.674	1.00
59_I	106_A	0.674	1.00
35_N	75_E	0.669	1.00
167_T	198_L	0.666	1.00
133_L	182_V	0.665	1.00
117_E	137_E	0.663	1.00
104_I	199_A	0.662	1.00
77_L	250_R	0.661	1.00
27_R	33_A	0.657	1.00
19_N	54_K	0.655	1.00
37_Q	40_D	0.651	1.00
160_K	177_E	0.648	1.00
182_V	185_V	0.648	1.00
59_I	196_I	0.647	1.00
230_D	234_R	0.647	1.00
16_V	19_N	0.647	1.00
45_V	49_L	0.644	1.00
112_A	136_P	0.643	1.00
47_N	50_D	0.643	1.00
143_M	216_A	0.642	1.00
186_V	191_L	0.640	1.00
20_I	59_I	0.638	1.00
60_I	103_V	0.634	1.00
14_I	48_K	0.633	1.00
57_V	203_A	0.624	1.00
38_M	41_E	0.624	1.00
127_A	131_A	0.623	1.00
52_D	101_K	0.622	1.00
57_V	104_I	0.622	1.00
174_K	185_V	0.618	1.00
110_I	170_L	0.616	1.00
150_Q	154_R	0.608	1.00
91_P	95_K	0.607	1.00
108_N	188_D	0.607	1.00
226_Q	230_D	0.606	1.00
216_A	231_F	0.605	1.00
243_K	247_E	0.605	1.00
166_L	210_I	0.604	1.00
250_R	253_L	0.603	1.00
14_I	23_I	0.602	1.00
134_G	168_G	0.600	1.00
20_I	196_I	0.600	1.00
247_E	251_A	0.599	1.00
149_T	228_G	0.597	1.00
158_K	217_V	0.596	1.00
56_K	203_A	0.593	1.00
91_P	94_E	0.593	1.00
234_R	238_L	0.593	1.00
208_I	242_T	0.592	1.00
44_D	47_N	0.591	1.00
126_I	195_A	0.591	1.00
191_L	194_E	0.590	1.00
113_G	136_P	0.587	1.00
171_I	176_A	0.586	1.00
105_A	125_I	0.586	1.00
126_I	191_L	0.584	1.00
156_L	161_A	0.583	1.00
30_K	72_D	0.582	1.00
144_P	213_A	0.581	1.00
42_L	92_L	0.579	1.00
130_S	173_S	0.579	1.00
116_L	181_L	0.578	1.00
126_I	194_E	0.578	1.00
247_E	250_R	0.576	1.00
167_T	201_E	0.575	1.00
137_E	145_G	0.575	1.00
49_L	101_K	0.574	1.00
20_I	199_A	0.574	1.00
99_F	102_P	0.571	1.00
119_A	122_C	0.570	1.00
213_A	216_A	0.570	1.00
135_Q	148_G	0.569	1.00
71_A	76_M	0.566	1.00
11_T	27_R	0.565	1.00
23_I	60_I	0.564	1.00
142_I	245_A	0.560	1.00
155_V	183_N	0.559	1.00
46_L	103_V	0.558	1.00
156_L	179_Y	0.555	1.00
163_E	198_L	0.554	1.00
167_T	202_I	0.548	1.00
163_E	175_E	0.548	1.00
39_V	43_V	0.547	1.00
125_I	182_V	0.545	1.00
77_L	253_L	0.544	1.00
135_Q	165_V	0.543	1.00
23_I	49_L	0.542	1.00
46_L	95_K	0.542	1.00
124_I	202_I	0.540	1.00
208_I	239_A	0.540	1.00
73_V	140_L	0.536	1.00
248_G	251_A	0.534	1.00
105_A	119_A	0.534	1.00
34_I	114_G	0.534	1.00
138_I	210_I	0.533	1.00
160_K	178_R	0.533	1.00
230_D	233_R	0.530	1.00
201_E	204_E	0.530	1.00
37_Q	75_E	0.528	1.00
172_D	178_R	0.524	1.00
90_M	94_E	0.524	1.00
121_A	151_R	0.523	1.00
138_I	205_K	0.523	1.00
173_S	177_E	0.522	1.00
23_I	46_L	0.520	1.00
128_S	131_A	0.519	1.00
137_E	144_P	0.518	1.00
223_T	228_G	0.518	1.00
117_E	135_Q	0.518	1.00
135_Q	152_L	0.515	1.00
247_E	254_E	0.515	1.00
55_I	58_V	0.510	1.00
97_R	218_A	0.508	1.00
24_K	192_I	0.508	1.00
244_E	248_G	0.508	1.00
153_T	156_L	0.506	1.00
162_M	214_K	0.505	1.00
154_R	224_L	0.504	1.00
153_T	161_A	0.503	1.00
214_K	218_A	0.502	1.00
106_A	199_A	0.501	1.00
117_E	145_G	0.501	1.00
88_G	91_P	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4lk5A	3	0.9436	100	0.097	Contact Map
1nzyA	4	0.9737	100	0.097	Contact Map
4jfcA	3	0.9474	100	0.101	Contact Map
2fbmA	3	0.9173	100	0.103	Contact Map
4mi2A	3	0.9549	100	0.104	Contact Map
1mj3A	5	0.9586	100	0.106	Contact Map
3g64A	6	0.9887	100	0.106	Contact Map
3qreA	3	0.7368	100	0.108	Contact Map
3bptA	1	0.9774	100	0.108	Contact Map
3peaA	3	0.9586	100	0.108	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0089 seconds.