Q97VJ8 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97VJ8 - Uncharacterized protein

UniProt:	Q97VJ8	Sequences: MQIDAIPLSIKYKIKYPDEFIEAVKRGEIVATKCKNCGSVYFPPQKDCYNCGKNEMEWIKVSNEGEIMTYSVVSQKPQGFENYEDYVIGIVKTKDGINIMAWIKGQPKVGNKVRLTTDGMRIIGEVIR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	128 (106)
Sequences:	2034 (1267)
Seq/√Len:	123.1

HALSA - Q9HRI9
SULSO - Q97VJ8 Q97UW9 Q7LXW3 Q97UA6 Q97WQ4 Q97WQ5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
28_E	60_K	3.235	1.00
37_C	51_C	2.737	1.00
67_I	113_V	2.733	1.00
33_K	59_I	2.721	1.00
36_N	55_E	2.587	1.00
35_K	57_E	2.480	1.00
37_C	48_C	2.463	1.00
94_K	112_K	2.425	1.00
48_C	51_C	2.384	1.00
64_E	94_K	2.377	1.00
23_A	30_V	2.323	1.00
18_D	22_E	2.256	1.00
65_G	113_V	2.237	1.00
92_K	98_N	2.119	1.00
34_C	37_C	2.096	1.00
34_C	51_C	2.020	1.00
34_C	48_C	2.002	1.00
27_G	119_G	1.908	1.00
41_Y	49_Y	1.881	1.00
67_I	89_G	1.841	1.00
35_K	55_E	1.804	1.00
39_S	50_N	1.802	1.00
32_T	41_Y	1.798	1.00
64_E	114_R	1.709	1.00
19_E	58_W	1.674	1.00
31_A	61_V	1.668	1.00
30_V	60_K	1.528	1.00
66_E	92_K	1.520	1.00
91_V	101_A	1.507	1.00
41_Y	56_M	1.492	1.00
89_G	103_I	1.478	1.00
70_Y	109_V	1.391	1.00
63_N	95_D	1.384	1.00
66_E	112_K	1.381	1.00
33_K	40_V	1.337	1.00
40_V	59_I	1.328	1.00
27_G	117_T	1.317	1.00
68_M	92_K	1.298	1.00
32_T	56_M	1.279	1.00
64_E	112_K	1.234	0.99
72_V	87_V	1.179	0.99
24_V	117_T	1.168	0.99
66_E	110_G	1.159	0.99
62_S	94_K	1.130	0.99
22_E	26_R	1.130	0.99
106_Q	111_N	1.108	0.99
69_T	90_I	1.102	0.99
31_A	97_I	1.079	0.99
17_P	21_I	1.067	0.98
65_G	91_V	0.995	0.97
53_K	56_M	0.994	0.97
15_K	18_D	0.976	0.97
71_S	88_I	0.976	0.97
89_G	101_A	0.975	0.97
19_E	23_A	0.962	0.97
16_Y	46_K	0.930	0.96
33_K	38_G	0.930	0.96
108_K	111_N	0.914	0.96
23_A	26_R	0.886	0.95
23_A	28_E	0.870	0.95
41_Y	45_Q	0.867	0.94
105_G	116_T	0.856	0.94
36_N	53_K	0.844	0.94
47_D	52_G	0.844	0.94
47_D	54_N	0.840	0.93
40_V	61_V	0.838	0.93
73_V	76_K	0.818	0.93
26_R	30_V	0.813	0.92
73_V	86_Y	0.812	0.92
68_M	98_N	0.811	0.92
24_V	115_L	0.809	0.92
90_I	100_M	0.803	0.92
67_I	111_N	0.797	0.92
20_F	24_V	0.791	0.91
103_I	106_Q	0.781	0.91
32_T	42_F	0.774	0.90
74_S	85_D	0.770	0.90
86_Y	102_W	0.768	0.90
33_K	57_E	0.764	0.90
63_N	115_L	0.764	0.90
19_E	22_E	0.752	0.89
70_Y	87_V	0.744	0.89
31_A	59_I	0.723	0.87
90_I	98_N	0.714	0.86
70_Y	103_I	0.714	0.86
67_I	109_V	0.700	0.85
31_A	40_V	0.679	0.84
20_F	23_A	0.676	0.83
39_S	49_Y	0.674	0.83
77_P	84_E	0.671	0.83
104_K	118_D	0.660	0.82
39_S	99_I	0.659	0.82
81_E	84_E	0.657	0.82
104_K	116_T	0.646	0.80
105_G	114_R	0.641	0.80
61_V	93_T	0.640	0.80
29_I	61_V	0.635	0.79
16_Y	40_V	0.633	0.79
87_V	107_P	0.619	0.78
45_Q	49_Y	0.616	0.77
105_G	118_D	0.616	0.77
44_P	58_W	0.606	0.76
61_V	95_D	0.604	0.76
65_G	99_I	0.598	0.75
22_E	25_K	0.595	0.75
87_V	103_I	0.590	0.74
34_C	53_K	0.585	0.74
16_Y	90_I	0.585	0.74
20_F	83_Y	0.579	0.73
69_T	109_V	0.577	0.73
21_I	42_F	0.575	0.72
62_S	95_D	0.574	0.72
25_K	107_P	0.570	0.72
71_S	74_S	0.567	0.71
38_G	59_I	0.566	0.71
48_C	53_K	0.563	0.71
37_C	50_N	0.560	0.70
21_I	85_D	0.559	0.70
64_E	111_N	0.558	0.70
47_D	56_M	0.556	0.70
42_F	99_I	0.553	0.69
65_G	101_A	0.552	0.69
103_I	113_V	0.548	0.69
31_A	93_T	0.548	0.69
67_I	70_Y	0.545	0.68
24_V	99_I	0.545	0.68
83_Y	121_R	0.544	0.68
70_Y	111_N	0.544	0.68
61_V	96_G	0.544	0.68
52_G	73_V	0.544	0.68
52_G	84_E	0.542	0.68
62_S	115_L	0.539	0.67
52_G	76_K	0.539	0.67
23_A	69_T	0.535	0.67
77_P	80_F	0.535	0.67
32_T	58_W	0.534	0.67
83_Y	102_W	0.533	0.67
92_K	97_I	0.532	0.66
20_F	99_I	0.530	0.66
65_G	94_K	0.528	0.66
73_V	80_F	0.526	0.66
72_V	89_G	0.520	0.65
17_P	42_F	0.517	0.64
20_F	115_L	0.514	0.64
17_P	115_L	0.513	0.64
29_I	42_F	0.513	0.64
74_S	107_P	0.512	0.64
63_N	101_A	0.512	0.64
21_I	102_W	0.511	0.63
29_I	85_D	0.511	0.63
30_V	58_W	0.509	0.63
71_S	120_M	0.509	0.63
45_Q	58_W	0.508	0.63
67_I	91_V	0.506	0.63
56_M	90_I	0.505	0.62
20_F	90_I	0.504	0.62
52_G	100_M	0.504	0.62
26_R	60_K	0.501	0.62
71_S	102_W	0.500	0.62

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3irbA	3	0.9609	100	0.257	Contact Map
2kdxA	1	0.5781	69.2	0.903	Contact Map
2lcqA	1	0.4766	63.6	0.906	Contact Map
5aunA	1	0.5781	59	0.909	Contact Map
4d02A	2	0.0547	58	0.91	Contact Map
3pwfA	4	0.4297	53	0.912	Contact Map
2conA	1	0.5547	48.4	0.914	Contact Map
4aybP	1	0.2969	47.3	0.915	Contact Map
1lkoA	3	0.5078	44.6	0.916	Contact Map
1s24A	1	0.2891	43.5	0.917	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.