Q97VJ2 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97VJ2 - Uncharacterized protein

UniProt:	Q97VJ2	Sequences: MKTGIIVGSNERSRLTYAAMTSVIISSMGDEVYVFLTMDAVKGFTKNPEVKSEDISSKIMVEKKEEDYMSLFRKAKKSGKVKIYACSYASKLFGYAKDDYNDIVDEIAGITTFSMDVEGGQIISVW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	126 (117)
Sequences:	748 (370)
Seq/√Len:	34.2

BACSU - YRKE
HALSA - O54564
SULSO - Q97VJ2 Q97Z17 Q97Z18

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
24_I	110_I	3.824	1.00
15_L	43_G	3.780	1.00
7_V	34_V	3.740	1.00
82_K	106_E	3.556	1.00
87_S	107_I	3.530	1.00
58_K	62_E	2.918	1.00
9_S	14_R	2.491	1.00
31_E	82_K	2.451	1.00
26_S	81_V	2.244	0.99
66_E	70_S	2.232	0.99
23_V	78_S	2.223	0.99
30_D	118_E	2.089	0.99
84_Y	108_A	2.054	0.98
4_G	113_F	1.997	0.98
113_F	122_I	1.956	0.98
19_A	36_L	1.859	0.97
4_G	120_G	1.816	0.96
113_F	117_V	1.804	0.96
75_A	81_V	1.777	0.96
33_Y	84_Y	1.755	0.96
16_T	56_S	1.734	0.95
90_S	100_Y	1.700	0.95
95_Y	100_Y	1.630	0.94
19_A	72_F	1.621	0.93
117_V	122_I	1.617	0.93
73_R	77_K	1.616	0.93
19_A	34_V	1.582	0.93
7_V	18_A	1.577	0.92
65_E	88_Y	1.568	0.92
23_V	75_A	1.541	0.92
104_V	107_I	1.532	0.91
36_L	44_F	1.518	0.91
82_K	116_D	1.493	0.90
21_T	110_I	1.492	0.90
8_G	13_S	1.464	0.89
5_I	21_T	1.425	0.88
76_K	103_I	1.357	0.85
41_V	85_A	1.305	0.83
97_K	106_E	1.291	0.82
23_V	71_L	1.268	0.81
34_V	83_I	1.261	0.81
54_D	57_S	1.256	0.80
13_S	39_D	1.256	0.80
67_D	70_S	1.194	0.77
53_E	57_S	1.139	0.73
53_E	56_S	1.134	0.73
20_M	71_L	1.103	0.71
8_G	17_Y	1.099	0.71
33_Y	113_F	1.095	0.70
33_Y	116_D	1.072	0.69
7_V	36_L	1.064	0.68
46_K	62_E	1.061	0.68
89_A	92_L	1.021	0.65
8_G	37_T	0.963	0.60
56_S	92_L	0.953	0.60
33_Y	82_K	0.949	0.59
70_S	117_V	0.947	0.59
12_R	57_S	0.941	0.59
66_E	74_K	0.939	0.58
46_K	102_D	0.908	0.56
87_S	109_G	0.903	0.55
109_G	112_T	0.878	0.53
17_Y	52_S	0.873	0.53
6_I	21_T	0.863	0.52
26_S	111_T	0.863	0.52
6_I	37_T	0.843	0.50
21_T	114_S	0.841	0.50
64_K	88_Y	0.840	0.50
16_T	38_M	0.831	0.49
8_G	14_R	0.807	0.47
14_R	17_Y	0.807	0.47
70_S	74_K	0.806	0.47
43_G	104_V	0.795	0.46
14_R	39_D	0.775	0.45
23_V	74_K	0.771	0.44
11_E	52_S	0.770	0.44
26_S	75_A	0.765	0.44
11_E	39_D	0.765	0.44
17_Y	110_I	0.764	0.44
30_D	121_Q	0.763	0.44
47_N	77_K	0.759	0.43
44_F	101_N	0.758	0.43
84_Y	114_S	0.752	0.43
79_G	93_F	0.750	0.42
30_D	122_I	0.738	0.41
24_I	111_T	0.730	0.41
83_I	91_K	0.728	0.41
58_K	61_V	0.723	0.40
85_A	104_V	0.712	0.39
90_S	108_A	0.707	0.39
19_A	44_F	0.705	0.39
73_R	76_K	0.700	0.38
73_R	78_S	0.696	0.38
27_S	61_V	0.690	0.38
10_N	20_M	0.690	0.38
63_K	91_K	0.687	0.37
73_R	98_D	0.687	0.37
59_I	92_L	0.683	0.37
50_V	61_V	0.681	0.37
59_I	62_E	0.675	0.36
8_G	16_T	0.668	0.36
65_E	92_L	0.657	0.35
43_G	76_K	0.656	0.35
89_A	99_D	0.652	0.35
27_S	109_G	0.647	0.34
84_Y	116_D	0.646	0.34
21_T	30_D	0.645	0.34
68_Y	99_D	0.644	0.34
76_K	106_E	0.634	0.33
97_K	103_I	0.634	0.33
22_S	84_Y	0.626	0.33
5_I	77_K	0.623	0.32
92_L	107_I	0.623	0.32
84_Y	117_V	0.621	0.32
10_N	13_S	0.621	0.32
61_V	64_K	0.618	0.32
45_T	95_Y	0.618	0.32
74_K	77_K	0.617	0.32
38_M	68_Y	0.617	0.32
90_S	107_I	0.616	0.32
41_V	91_K	0.615	0.32
57_S	98_D	0.607	0.31
24_I	39_D	0.601	0.31
52_S	93_F	0.599	0.31
51_K	62_E	0.599	0.31
37_T	89_A	0.598	0.31
6_I	46_K	0.592	0.30
41_V	93_F	0.591	0.30
70_S	121_Q	0.589	0.30
38_M	89_A	0.588	0.30
57_S	82_K	0.583	0.30
8_G	39_D	0.582	0.29
18_A	34_V	0.575	0.29
22_S	103_I	0.575	0.29
85_A	107_I	0.575	0.29
108_A	112_T	0.574	0.29
72_F	83_I	0.568	0.28
45_T	99_D	0.566	0.28
55_I	60_M	0.565	0.28
115_M	119_G	0.564	0.28
39_D	93_F	0.559	0.28
11_E	17_Y	0.558	0.28
47_N	51_K	0.558	0.28
68_Y	78_S	0.557	0.28
88_Y	91_K	0.554	0.28
63_K	92_L	0.553	0.27
16_T	71_L	0.552	0.27
74_K	118_E	0.551	0.27
87_S	91_K	0.551	0.27
23_V	62_E	0.551	0.27
23_V	26_S	0.550	0.27
15_L	68_Y	0.549	0.27
119_G	122_I	0.548	0.27
51_K	82_K	0.547	0.27
23_V	27_S	0.546	0.27
51_K	61_V	0.545	0.27
32_V	118_E	0.543	0.27
41_V	90_S	0.539	0.27
31_E	119_G	0.536	0.26
60_M	110_I	0.534	0.26
56_S	121_Q	0.530	0.26
25_I	111_T	0.527	0.26
71_L	89_A	0.527	0.26
54_D	58_K	0.525	0.26
6_I	58_K	0.525	0.26
28_M	73_R	0.524	0.26
98_D	107_I	0.523	0.25
30_D	66_E	0.518	0.25
26_S	78_S	0.518	0.25
44_F	88_Y	0.514	0.25
27_S	111_T	0.513	0.25
12_R	16_T	0.513	0.25
84_Y	106_E	0.512	0.25
78_S	83_I	0.508	0.25
96_A	99_D	0.504	0.24
57_S	69_M	0.500	0.24

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3pnxA	4	0.9762	100	0.34	Contact Map
2qs7A	3	0.9921	100	0.353	Contact Map
3mc3A	3	0.8333	99.8	0.615	Contact Map
1jx7A	5	0.8889	99.6	0.667	Contact Map
2hy5B	1	0.9048	99.5	0.689	Contact Map
1l1sA	3	0.8413	99.4	0.699	Contact Map
2d1pB	1	0.9048	99.3	0.721	Contact Map
2hy5A	2	0.8968	99.2	0.729	Contact Map
2pd2A	3	0.8254	99	0.747	Contact Map
2d1pA	2	0.8968	98.9	0.757	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.