Q97VI6 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97VI6 - Carbon monoxide dehydrogenase, small chain. Amino-end (CutC-2)

UniProt:	Q97VI6	Sequences: MLMVNQGEKIKIKVKVNGVLYERYVSPRILLVDFLREELGLTGTKIGCDTTTCGACTVLLNGKSVKSCTLFAVQADGAEITTIEGLSVDSKLHPIQEAFKENFALQCGFCTPGMIMQAYFLLKENPNPSEEEVRDGLHGNICRCTGYQNIVKAVLDASRRLRA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	163 (148)
Sequences:	6797 (3961)
Seq/√Len:	325.6

ECOLI - XDHD YAGT XDHC
BACSU - XDHE
SULSO - Q97VI6 Q97W14

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
102_N	156_D	3.986	1.00
130_E	155_L	3.804	1.00
29_I	38_E	3.243	1.00
93_H	119_Y	2.711	1.00
43_G	83_I	2.573	1.00
133_V	155_L	2.570	1.00
129_S	132_E	2.533	1.00
15_K	79_E	2.525	1.00
23_R	34_F	2.428	1.00
61_N	78_A	2.355	1.00
97_E	101_E	2.298	1.00
102_N	152_K	2.251	1.00
118_A	154_V	2.017	1.00
13_K	22_E	2.009	1.00
32_V	46_I	1.954	1.00
51_T	69_T	1.949	1.00
57_T	64_S	1.926	1.00
95_I	115_I	1.918	1.00
60_L	65_V	1.876	1.00
41_L	44_T	1.841	1.00
101_E	156_D	1.835	1.00
119_Y	123_K	1.822	1.00
29_I	34_F	1.799	1.00
34_F	72_A	1.798	1.00
59_L	116_M	1.797	1.00
60_L	70_L	1.796	1.00
15_K	20_L	1.775	1.00
83_I	115_I	1.769	1.00
13_K	20_L	1.691	1.00
125_N	132_E	1.679	1.00
134_R	151_V	1.659	1.00
46_I	49_D	1.576	1.00
71_F	74_Q	1.489	1.00
43_G	84_E	1.473	1.00
95_I	119_Y	1.429	1.00
17_N	84_E	1.394	1.00
17_N	41_L	1.377	1.00
64_S	120_F	1.373	1.00
125_N	128_P	1.370	1.00
57_T	116_M	1.334	1.00
59_L	120_F	1.325	1.00
130_E	152_K	1.305	1.00
137_L	154_V	1.302	1.00
25_V	72_A	1.280	1.00
92_L	96_Q	1.275	1.00
81_T	85_G	1.253	1.00
16_V	39_L	1.251	1.00
31_L	58_V	1.251	1.00
104_A	153_A	1.249	1.00
120_F	124_E	1.246	1.00
114_M	137_L	1.245	1.00
121_L	136_G	1.239	1.00
60_L	80_I	1.232	1.00
59_L	119_Y	1.230	1.00
99_F	111_T	1.221	1.00
14_V	21_Y	1.220	1.00
87_S	92_L	1.203	1.00
70_L	75_A	1.133	1.00
60_L	78_A	1.126	1.00
65_V	70_L	1.126	1.00
31_L	80_I	1.121	1.00
148_Q	152_K	1.113	1.00
95_I	118_A	1.098	1.00
88_V	91_K	1.096	1.00
117_Q	139_G	1.081	1.00
16_V	21_Y	1.081	1.00
130_E	134_R	1.065	1.00
95_I	157_A	1.064	1.00
12_I	76_D	1.049	1.00
89_D	92_L	1.048	1.00
128_P	158_S	1.023	1.00
149_N	152_K	1.011	1.00
60_L	75_A	1.005	1.00
34_F	39_L	0.993	1.00
31_L	75_A	0.989	1.00
44_T	83_I	0.988	1.00
93_H	96_Q	0.986	1.00
86_L	119_Y	0.982	1.00
26_S	29_I	0.970	1.00
32_V	44_T	0.967	1.00
25_V	38_E	0.964	1.00
41_L	84_E	0.955	1.00
23_R	39_L	0.938	1.00
64_S	117_Q	0.927	1.00
104_A	111_T	0.921	1.00
113_G	140_N	0.919	1.00
130_E	151_V	0.918	1.00
91_K	97_E	0.915	1.00
30_L	33_D	0.903	1.00
16_V	41_L	0.871	1.00
63_K	124_E	0.871	1.00
81_T	123_K	0.867	1.00
87_S	91_K	0.865	1.00
75_A	78_A	0.829	1.00
122_L	158_S	0.829	1.00
151_V	155_L	0.827	1.00
95_I	122_L	0.817	1.00
18_G	79_E	0.815	1.00
61_N	79_E	0.814	1.00
86_L	115_I	0.807	1.00
59_L	81_T	0.804	1.00
94_P	157_A	0.800	1.00
125_N	136_G	0.799	1.00
98_A	156_D	0.790	1.00
118_A	137_L	0.787	1.00
58_V	67_S	0.787	1.00
18_G	21_Y	0.786	1.00
103_F	145_T	0.785	1.00
156_D	159_R	0.784	1.00
99_F	104_A	0.777	1.00
99_F	118_A	0.774	1.00
30_L	46_I	0.772	1.00
35_L	58_V	0.771	1.00
114_M	146_G	0.768	1.00
103_F	146_G	0.767	1.00
99_F	115_I	0.765	1.00
32_V	47_G	0.762	1.00
121_L	125_N	0.758	0.99
131_E	135_D	0.758	0.99
98_A	157_A	0.758	0.99
13_K	76_D	0.756	0.99
87_S	96_Q	0.756	0.99
114_M	150_I	0.756	0.99
70_L	74_Q	0.753	0.99
131_E	134_R	0.750	0.99
49_D	52_T	0.749	0.99
124_E	136_G	0.726	0.99
42_T	112_P	0.719	0.99
117_Q	136_G	0.717	0.99
133_V	151_V	0.712	0.99
64_S	136_G	0.704	0.99
33_D	46_I	0.701	0.99
34_F	38_E	0.699	0.99
17_N	85_G	0.697	0.99
29_I	37_E	0.696	0.99
152_K	156_D	0.694	0.99
99_F	114_M	0.692	0.99
87_S	90_S	0.691	0.99
14_V	34_F	0.683	0.99
28_R	73_V	0.681	0.99
99_F	105_L	0.680	0.99
66_K	70_L	0.674	0.99
102_N	153_A	0.673	0.99
132_E	136_G	0.673	0.99
114_M	140_N	0.672	0.99
25_V	34_F	0.668	0.99
105_L	111_T	0.666	0.99
121_L	133_V	0.666	0.99
30_L	71_F	0.660	0.99
33_D	37_E	0.658	0.99
121_L	128_P	0.655	0.99
122_L	125_N	0.652	0.98
122_L	128_P	0.651	0.98
121_L	126_P	0.650	0.98
12_I	25_V	0.649	0.98
42_T	45_K	0.647	0.98
35_L	39_L	0.645	0.98
92_L	100_K	0.643	0.98
45_K	112_P	0.639	0.98
81_T	119_Y	0.634	0.98
59_L	64_S	0.634	0.98
12_I	72_A	0.630	0.98
114_M	139_G	0.630	0.98
53_C	56_C	0.629	0.98
29_I	72_A	0.628	0.98
35_L	44_T	0.627	0.98
48_C	53_C	0.625	0.98
122_L	157_A	0.625	0.98
57_T	117_Q	0.622	0.98
48_C	56_C	0.619	0.98
23_R	38_E	0.614	0.98
117_Q	140_N	0.611	0.98
14_V	23_R	0.611	0.98
21_Y	34_F	0.610	0.98
103_F	149_N	0.609	0.98
45_K	66_K	0.607	0.98
30_L	50_T	0.605	0.98
86_L	116_M	0.604	0.97
88_V	92_L	0.599	0.97
62_G	79_E	0.597	0.97
145_T	148_Q	0.590	0.97
46_I	52_T	0.590	0.97
122_L	126_P	0.584	0.97
100_K	105_L	0.581	0.97
70_L	78_A	0.579	0.97
52_T	66_K	0.577	0.97
139_G	147_Y	0.575	0.97
50_T	66_K	0.573	0.97
116_M	136_G	0.571	0.96
133_V	154_V	0.568	0.96
59_L	123_K	0.567	0.96
44_T	84_E	0.563	0.96
37_E	42_T	0.558	0.96
62_G	78_A	0.557	0.96
35_L	42_T	0.554	0.96
45_K	103_F	0.551	0.96
86_L	93_H	0.549	0.96
72_A	75_A	0.545	0.95
46_I	66_K	0.543	0.95
31_L	70_L	0.537	0.95
16_V	35_L	0.532	0.95
128_P	136_G	0.530	0.95
57_T	140_N	0.530	0.95
46_I	109_F	0.528	0.95
114_M	145_T	0.521	0.94
28_R	71_F	0.521	0.94
49_D	66_K	0.517	0.94
90_S	93_H	0.515	0.94
27_P	73_V	0.513	0.94
127_N	159_R	0.513	0.94
56_C	68_C	0.512	0.94
30_L	49_D	0.510	0.94
90_S	96_Q	0.510	0.94
85_G	92_L	0.509	0.93
43_G	96_Q	0.509	0.93
48_C	68_C	0.508	0.93
25_V	73_V	0.508	0.93
14_V	76_D	0.506	0.93
66_K	117_Q	0.504	0.93
117_Q	121_L	0.503	0.93
50_T	69_T	0.503	0.93
14_V	75_A	0.500	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3uncA	2	0.9202	100	0.06	Contact Map
3zyvA	3	0.9264	100	0.064	Contact Map
3nvwA	1	0.9325	100	0.106	Contact Map
2w3sA	1	0.9141	100	0.106	Contact Map
1dgjA	1	0.9509	100	0.122	Contact Map
4usaA	2	0.9509	100	0.135	Contact Map
1n62A	1	0.9509	100	0.187	Contact Map
3hrdD	1	0.9632	100	0.194	Contact Map
1rm6C	1	0.9571	100	0.245	Contact Map
1t3qA	1	0.9632	100	0.249	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.