Q97VH2 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97VH2 - Uncharacterized protein

UniProt:	Q97VH2	Sequences: MKWKYIAIIYALYIIISIVVKIIGEVNFLGNVYFFYLINHSQLPALNPIMIFFSKYGREYIWIPVTAILFIMGGKFRRSSLLLVGGFIIAIILGEVSKYVMAQPRPFLILHNINLLVPEPTDYSYPSGHALIVAVGAVIVLLTLPYYISIPLFIEALLTSYSRVYVGVHWPLDVLVGWILGIAIALTATNLEKLITTIYNRVVNLILGNMRKTNLKRPK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	219 (181)
Sequences:	5873 (4505)
Seq/√Len:	334.8

ECOLI - YBJG PGPB
BACSU - BCRC YODM
HALSA - Q9HRC2 Q9HNI3
SULSO - Q97VH2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
160_S	178_W	4.431	1.00
94_G	131_L	3.909	1.00
138_V	185_A	3.870	1.00
102_A	123_Y	3.320	1.00
90_A	135_V	2.999	1.00
103_Q	172_L	2.904	1.00
142_L	189_T	2.901	1.00
89_I	184_I	2.549	1.00
97_S	101_M	2.479	1.00
125_Y	176_V	2.408	1.00
31_N	103_Q	2.377	1.00
130_A	160_S	2.374	1.00
47_N	165_Y	2.332	1.00
90_A	131_L	2.291	1.00
177_G	181_G	2.232	1.00
138_V	182_I	2.211	1.00
134_A	156_A	2.173	1.00
50_M	161_Y	2.066	1.00
21_K	24_G	2.021	1.00
134_A	178_W	1.948	1.00
70_F	74_G	1.892	1.00
134_A	160_S	1.883	1.00
130_A	178_W	1.881	1.00
15_I	19_V	1.875	1.00
32_V	36_Y	1.841	1.00
133_V	159_T	1.828	1.00
15_I	18_I	1.824	1.00
86_G	135_V	1.794	1.00
35_F	164_V	1.770	1.00
130_A	134_A	1.704	1.00
17_S	20_V	1.701	1.00
137_A	156_A	1.659	1.00
160_S	174_V	1.624	1.00
35_F	171_P	1.608	1.00
186_L	190_N	1.600	1.00
55_K	58_R	1.582	1.00
130_A	177_G	1.567	1.00
13_Y	17_S	1.562	1.00
126_P	180_L	1.524	1.00
164_V	174_V	1.515	1.00
11_A	15_I	1.506	1.00
181_G	185_A	1.483	1.00
53_F	159_T	1.446	1.00
184_I	188_A	1.422	1.00
61_I	64_P	1.403	1.00
54_S	162_S	1.399	1.00
141_L	149_S	1.397	1.00
97_S	126_P	1.379	1.00
56_Y	155_E	1.338	1.00
37_L	41_S	1.335	1.00
71_I	75_K	1.313	1.00
39_N	42_Q	1.302	1.00
98_K	128_G	1.279	1.00
103_Q	170_W	1.277	1.00
60_Y	64_P	1.256	1.00
43_L	46_L	1.250	1.00
50_M	162_S	1.244	1.00
16_I	20_V	1.239	1.00
77_R	81_L	1.239	1.00
141_L	152_L	1.229	1.00
137_A	152_L	1.206	1.00
124_S	173_D	1.191	1.00
48_P	51_I	1.170	1.00
134_A	185_A	1.165	1.00
124_S	170_W	1.156	1.00
13_Y	20_V	1.152	1.00
131_L	180_L	1.137	1.00
64_P	67_A	1.121	1.00
14_I	18_I	1.119	1.00
46_L	50_M	1.114	1.00
48_P	52_F	1.093	1.00
95_E	99_Y	1.089	1.00
53_F	158_L	1.086	1.00
19_V	22_I	1.079	1.00
33_Y	37_L	1.064	1.00
96_V	100_V	1.058	1.00
149_S	152_L	1.041	1.00
137_A	155_E	1.037	1.00
35_F	39_N	1.018	1.00
164_V	171_P	1.010	1.00
126_P	176_V	1.006	1.00
60_Y	63_I	1.005	1.00
50_M	54_S	1.002	1.00
182_I	186_L	0.993	1.00
99_Y	123_Y	0.981	1.00
120_P	168_V	0.976	1.00
94_G	128_G	0.974	1.00
144_L	152_L	0.967	1.00
138_V	142_L	0.950	1.00
85_G	88_I	0.943	1.00
101_M	125_Y	0.941	1.00
60_Y	66_T	0.937	1.00
17_S	21_K	0.936	1.00
49_I	53_F	0.931	1.00
47_N	51_I	0.924	1.00
20_V	24_G	0.920	1.00
189_T	193_K	0.917	1.00
142_L	185_A	0.914	1.00
89_I	188_A	0.907	1.00
28_F	32_V	0.897	1.00
15_I	22_I	0.892	1.00
54_S	166_V	0.885	1.00
79_S	83_L	0.884	1.00
90_A	94_G	0.881	1.00
130_A	174_V	0.879	1.00
129_H	169_H	0.874	1.00
82_L	139_I	0.869	1.00
38_I	164_V	0.864	1.00
107_F	111_H	0.862	1.00
37_L	40_H	0.861	1.00
83_L	139_I	0.859	1.00
59_E	64_P	0.858	1.00
160_S	164_V	0.855	1.00
146_Y	150_I	0.855	1.00
103_Q	124_S	0.848	1.00
153_F	156_A	0.847	1.00
91_I	95_E	0.845	1.00
158_L	162_S	0.844	1.00
138_V	181_G	0.842	1.00
139_I	142_L	0.842	1.00
98_K	105_R	0.842	1.00
34_F	37_L	0.840	1.00
86_G	89_I	0.836	1.00
183_A	186_L	0.831	1.00
49_I	158_L	0.825	1.00
133_V	156_A	0.819	1.00
14_I	23_I	0.817	1.00
80_S	83_L	0.813	1.00
19_V	23_I	0.813	1.00
31_N	172_L	0.806	1.00
117_V	168_V	0.805	1.00
142_L	193_K	0.805	1.00
68_I	72_M	0.804	1.00
82_L	188_A	0.801	1.00
138_V	153_F	0.791	1.00
90_A	184_I	0.791	1.00
104_P	108_L	0.786	1.00
171_P	175_L	0.786	1.00
20_V	23_I	0.778	1.00
145_P	149_S	0.778	1.00
71_I	74_G	0.777	1.00
157_L	178_W	0.774	1.00
82_L	142_L	0.761	1.00
15_I	20_V	0.752	1.00
59_E	132_I	0.751	1.00
134_A	153_F	0.750	1.00
38_I	167_G	0.750	1.00
79_S	82_L	0.749	0.99
193_K	196_T	0.741	0.99
161_Y	165_Y	0.741	0.99
156_A	178_W	0.739	0.99
97_S	180_L	0.738	0.99
13_Y	18_I	0.738	0.99
16_I	23_I	0.735	0.99
41_S	44_P	0.732	0.99
45_A	50_M	0.725	0.99
93_L	184_I	0.724	0.99
107_F	170_W	0.722	0.99
30_G	33_Y	0.718	0.99
131_L	177_G	0.716	0.99
150_I	154_I	0.716	0.99
11_A	16_I	0.712	0.99
180_L	184_I	0.711	0.99
54_S	57_G	0.710	0.99
148_I	152_L	0.706	0.99
54_S	163_R	0.706	0.99
125_Y	173_D	0.705	0.99
83_L	87_F	0.703	0.99
29_L	33_Y	0.700	0.99
100_V	104_P	0.699	0.99
72_M	75_K	0.699	0.99
133_V	137_A	0.695	0.99
69_L	73_G	0.693	0.99
17_S	24_G	0.689	0.99
86_G	185_A	0.687	0.99
17_S	23_I	0.686	0.99
45_A	49_I	0.684	0.99
85_G	192_E	0.682	0.99
42_Q	47_N	0.680	0.99
71_I	76_F	0.679	0.99
78_R	82_L	0.678	0.99
172_L	176_V	0.676	0.99
45_A	48_P	0.667	0.99
62_W	66_T	0.667	0.99
12_L	22_I	0.666	0.99
102_A	122_D	0.664	0.99
12_L	19_V	0.655	0.99
19_V	24_G	0.655	0.99
134_A	157_L	0.652	0.99
134_A	182_I	0.646	0.99
188_A	192_E	0.646	0.99
44_P	48_P	0.643	0.98
139_I	185_A	0.643	0.98
14_I	20_V	0.642	0.98
25_E	28_F	0.640	0.98
178_W	182_I	0.639	0.98
62_W	65_V	0.636	0.98
137_A	141_L	0.636	0.98
41_S	161_Y	0.636	0.98
22_I	27_N	0.633	0.98
18_I	21_K	0.628	0.98
16_I	21_K	0.627	0.98
16_I	19_V	0.627	0.98
18_I	22_I	0.622	0.98
34_F	38_I	0.619	0.98
128_G	169_H	0.618	0.98
91_I	94_G	0.617	0.98
15_I	23_I	0.610	0.98
175_L	178_W	0.610	0.98
87_F	136_G	0.609	0.98
131_L	156_A	0.608	0.98
107_F	120_P	0.606	0.98
47_N	50_M	0.605	0.98
139_I	189_T	0.601	0.98
57_G	159_T	0.601	0.98
13_Y	21_K	0.600	0.98
162_S	166_V	0.598	0.98
87_F	90_A	0.598	0.98
92_I	96_V	0.594	0.97
92_I	95_E	0.594	0.97
107_F	168_V	0.592	0.97
13_Y	22_I	0.591	0.97
24_G	27_N	0.590	0.97
52_F	55_K	0.587	0.97
93_L	180_L	0.584	0.97
108_L	111_H	0.582	0.97
108_L	121_T	0.582	0.97
60_Y	71_I	0.582	0.97
34_F	164_V	0.579	0.97
139_I	143_T	0.579	0.97
63_I	66_T	0.579	0.97
130_A	133_V	0.577	0.97
11_A	18_I	0.577	0.97
26_V	29_L	0.576	0.97
12_L	21_K	0.572	0.97
13_Y	16_I	0.572	0.97
107_F	119_E	0.570	0.97
20_V	25_E	0.569	0.97
94_G	180_L	0.562	0.96
16_I	22_I	0.561	0.96
141_L	153_F	0.559	0.96
11_A	14_I	0.559	0.96
131_L	135_V	0.557	0.96
14_I	17_S	0.556	0.96
110_L	167_G	0.556	0.96
86_G	139_I	0.555	0.96
60_Y	80_S	0.555	0.96
32_V	38_I	0.552	0.96
35_F	166_V	0.550	0.96
141_L	144_L	0.550	0.96
90_A	132_I	0.549	0.96
68_I	73_G	0.548	0.96
34_F	171_P	0.545	0.96
61_I	65_V	0.545	0.96
46_L	49_I	0.545	0.96
12_L	16_I	0.543	0.96
172_L	175_L	0.543	0.96
68_I	71_I	0.541	0.96
179_I	182_I	0.536	0.95
42_Q	46_L	0.534	0.95
86_G	93_L	0.532	0.95
51_I	55_K	0.532	0.95
111_H	120_P	0.529	0.95
64_P	73_G	0.516	0.94
43_L	47_N	0.515	0.94
12_L	15_I	0.513	0.94
144_L	148_I	0.510	0.94
110_L	118_P	0.508	0.94
14_I	19_V	0.507	0.94
88_I	92_I	0.502	0.94
82_L	143_T	0.502	0.94
14_I	21_K	0.500	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4px7A	1	0.9315	100	0.389	Contact Map
1d2tA	5	0.9406	99.9	0.498	Contact Map
4citA	1	0.8858	99.9	0.508	Contact Map
1qi9A	2	0.8995	99.9	0.522	Contact Map
1up8A	9	0.895	99.9	0.524	Contact Map
2ipbA	2	0.9498	99.9	0.526	Contact Map
3w36A	2	0.8813	99.8	0.556	Contact Map
3bb0A	1	0.968	99.7	0.609	Contact Map
2kluA	1	0.242	48.9	0.921	Contact Map
2kncB	1	0.2237	19.7	0.936	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.