Q97VE0 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97VE0 - Mercury resistance operon repressor, probable (MerR)

UniProt:	Q97VE0	Sequences: MEPLTNELESLFSALADGTRLRIVLFLLDKGQATVDEISKSLGKSQSLISHHMACLRNCGIVKVRKDGKFSYYSISTPEIIELIKLSINHVKKYSQSILSCDVLAEEKGQVKLSH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	115 (89)
Sequences:	5248 (3501)
Seq/√Len:	371.1

ECOLI - YGAV ARSR
BACSU - ASER ARSR CZRA SDPR YBZH YCEK
HALSA - ARSR2
SULSO - Q97VE0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
32_Q	65_R	4.025	1.00
64_V	71_S	3.230	1.00
63_K	74_S	2.762	1.00
63_K	76_S	2.416	1.00
14_A	59_C	2.300	1.00
66_K	71_S	2.242	1.00
6_N	18_G	2.218	1.00
54_A	58_N	1.907	1.00
57_R	64_V	1.854	1.00
32_Q	74_S	1.845	1.00
44_K	49_I	1.800	1.00
33_A	41_S	1.719	1.00
26_F	41_S	1.680	1.00
39_S	46_Q	1.575	1.00
53_M	62_V	1.574	1.00
27_L	33_A	1.525	1.00
45_S	48_L	1.496	1.00
55_C	59_C	1.483	1.00
34_T	70_F	1.481	1.00
34_T	37_E	1.440	1.00
10_S	58_N	1.432	1.00
24_V	61_I	1.393	1.00
44_K	48_L	1.372	1.00
33_A	37_E	1.370	1.00
82_E	86_L	1.368	1.00
23_I	38_I	1.347	1.00
14_A	55_C	1.297	1.00
12_F	87_S	1.296	1.00
26_F	33_A	1.238	1.00
9_E	18_G	1.230	1.00
19_T	44_K	1.223	1.00
60_G	76_S	1.194	1.00
38_I	49_I	1.176	1.00
28_L	81_I	1.174	1.00
5_T	25_L	1.171	1.00
48_L	51_H	1.167	1.00
35_V	53_M	1.158	1.00
27_L	62_V	1.156	1.00
17_D	51_H	1.141	1.00
67_D	70_F	1.117	1.00
42_L	49_I	1.114	1.00
8_L	87_S	1.105	1.00
81_I	85_K	1.069	1.00
55_C	58_N	1.057	1.00
82_E	89_N	1.056	1.00
22_R	26_F	1.053	1.00
79_E	90_H	1.049	1.00
78_P	81_I	1.042	1.00
19_T	49_I	1.037	1.00
11_L	61_I	0.997	1.00
12_F	83_L	0.993	1.00
84_I	88_I	0.981	1.00
32_Q	67_D	0.980	1.00
39_S	49_I	0.972	1.00
37_E	40_K	0.966	1.00
24_V	75_I	0.952	1.00
54_A	57_R	0.951	1.00
45_S	69_K	0.945	1.00
85_K	89_N	0.926	1.00
51_H	69_K	0.911	1.00
56_L	62_V	0.904	1.00
9_E	21_L	0.880	1.00
63_K	77_T	0.878	1.00
32_Q	72_Y	0.850	1.00
6_N	10_S	0.841	1.00
37_E	41_S	0.829	1.00
23_I	27_L	0.828	1.00
26_F	38_I	0.827	1.00
5_T	22_R	0.826	1.00
88_I	92_K	0.805	1.00
25_L	28_L	0.787	1.00
12_F	15_L	0.777	1.00
82_E	85_K	0.772	1.00
45_S	52_H	0.770	1.00
29_D	33_A	0.767	1.00
35_V	57_R	0.766	1.00
34_T	72_Y	0.759	1.00
15_L	24_V	0.756	1.00
36_D	39_S	0.745	1.00
83_L	87_S	0.741	1.00
86_L	89_N	0.738	1.00
45_S	51_H	0.721	1.00
36_D	70_F	0.719	1.00
13_S	16_A	0.707	0.99
57_R	62_V	0.701	0.99
76_S	79_E	0.690	0.99
39_S	43_G	0.689	0.99
78_P	82_E	0.686	0.99
36_D	40_K	0.676	0.99
65_R	74_S	0.670	0.99
77_T	80_I	0.670	0.99
23_I	49_I	0.668	0.99
51_H	55_C	0.666	0.99
28_L	75_I	0.664	0.99
24_V	84_I	0.642	0.99
8_L	88_I	0.641	0.99
7_E	60_G	0.638	0.99
85_K	88_I	0.637	0.99
26_F	42_L	0.636	0.99
53_M	57_R	0.628	0.99
19_T	22_R	0.620	0.99
90_H	94_Y	0.613	0.99
25_L	92_K	0.607	0.98
13_S	66_K	0.606	0.98
79_E	93_K	0.601	0.98
48_L	52_H	0.595	0.98
31_G	37_E	0.588	0.98
19_T	52_H	0.582	0.98
12_F	16_A	0.578	0.98
21_L	24_V	0.576	0.98
13_S	17_D	0.574	0.98
17_D	48_L	0.558	0.97
57_R	71_S	0.551	0.97
37_E	70_F	0.547	0.97
17_D	45_S	0.546	0.97
35_V	46_Q	0.546	0.97
79_E	83_L	0.540	0.97
47_S	68_G	0.538	0.97
77_T	90_H	0.534	0.96
39_S	45_S	0.530	0.96
25_L	29_D	0.530	0.96
27_L	31_G	0.530	0.96
14_A	61_I	0.529	0.96
23_I	53_M	0.523	0.96
67_D	72_Y	0.523	0.96
84_I	91_V	0.518	0.96
81_I	94_Y	0.517	0.96
7_E	18_G	0.517	0.96
80_I	90_H	0.517	0.96
18_G	22_R	0.511	0.96
28_L	85_K	0.504	0.95
42_L	45_S	0.503	0.95
11_L	80_I	0.502	0.95
25_L	88_I	0.500	0.95

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1r1tA	2	0.8087	99.7	0.5	Contact Map
1u2wA	2	0.8261	99.7	0.505	Contact Map
2kkoA	2	0.8783	99.7	0.512	Contact Map
3pqkA	2	0.8435	99.6	0.515	Contact Map
2jscA	2	0.8435	99.6	0.516	Contact Map
4k2eA	2	0.8	99.6	0.521	Contact Map
3cuoA	2	0.8	99.6	0.531	Contact Map
1r1uA	2	0.8261	99.6	0.531	Contact Map
1q1hA	1	0.7043	99.6	0.534	Contact Map
3f6vA	2	0.8348	99.6	0.534	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.