Q97V76 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97V76 - Pyruvate synthase gamma chain (Pyruvic-ferredoxin oxidoreductase gamma chain) (PorG-2)

UniProt:	Q97V76	Sequences: MLEIRFHGRGGQGVVTASQLLAEAAGYENLYTSSFPIYGAERRGAEIEAYCRISDTPIRVTSPVEEPDYLVVIDNSLIQISRSLFRGLKDTSTILLNSPSKPDLRWRTFYVNATKIATDLGLVKSGWPMVNVIILGALIRVMGMPKLSSLEKAIEEEFDGKVAQLNIKGARLAYGQVGVEYVTA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	184 (172)
Sequences:	4461 (2933)
Seq/√Len:	223.7

ECOLI - NIFJ
HALSA - Q9HQJ9 Q9HRZ5
SULSO - Q97V76 Q97YU7 Q97WQ1 Q97V21 Q7LX70

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
151_E	171_R	4.230	1.00
119_D	123_V	3.582	1.00
88_L	92_S	3.293	1.00
164_Q	168_K	3.140	1.00
28_E	149_S	2.835	1.00
116_I	119_D	2.747	1.00
93_T	111_V	2.732	1.00
154_I	170_A	2.535	1.00
151_E	167_I	2.484	1.00
123_V	172_L	2.475	1.00
171_R	175_G	2.465	1.00
152_K	155_E	2.431	1.00
155_E	167_I	2.419	1.00
28_E	146_K	2.358	1.00
68_D	89_K	2.358	1.00
172_L	175_G	2.182	1.00
146_K	149_S	2.166	1.00
90_D	109_F	1.998	1.00
27_Y	152_K	1.982	1.00
147_L	174_Y	1.960	1.00
5_R	87_G	1.874	1.00
69_Y	138_L	1.831	1.00
124_K	172_L	1.794	1.00
30_L	55_D	1.789	1.00
140_R	174_Y	1.785	1.00
129_M	165_L	1.725	1.00
31_Y	57_P	1.718	1.00
168_K	172_L	1.706	1.00
25_A	53_I	1.655	1.00
147_L	171_R	1.636	1.00
164_Q	167_I	1.627	1.00
72_V	78_I	1.606	1.00
136_G	173_A	1.605	1.00
139_I	150_L	1.595	1.00
27_Y	156_E	1.581	1.00
133_I	169_G	1.577	1.00
120_L	176_Q	1.576	1.00
22_A	34_S	1.534	1.00
139_I	174_Y	1.520	1.00
147_L	151_E	1.494	1.00
120_L	133_I	1.479	1.00
89_K	92_S	1.477	1.00
120_L	172_L	1.470	1.00
71_V	138_L	1.469	1.00
151_E	155_E	1.468	1.00
158_F	162_V	1.458	1.00
3_E	52_R	1.424	1.00
147_L	170_A	1.398	1.00
148_S	151_E	1.340	1.00
167_I	171_R	1.325	1.00
96_L	114_T	1.318	1.00
16_T	158_F	1.300	1.00
120_L	123_V	1.288	1.00
98_S	116_I	1.287	1.00
97_N	118_T	1.283	1.00
99_P	116_I	1.273	1.00
117_A	134_I	1.258	1.00
90_D	108_T	1.255	1.00
124_K	133_I	1.240	1.00
172_L	176_Q	1.221	1.00
98_S	114_T	1.213	1.00
116_I	176_Q	1.211	1.00
69_Y	95_L	1.197	1.00
137_A	177_V	1.190	1.00
165_L	168_K	1.181	1.00
70_L	94_I	1.180	1.00
152_K	156_E	1.175	1.00
168_K	171_R	1.174	1.00
121_G	133_I	1.158	1.00
99_P	119_D	1.156	1.00
9_R	74_D	1.155	1.00
95_L	141_V	1.140	1.00
96_L	112_N	1.140	1.00
113_A	141_V	1.130	1.00
148_S	152_K	1.128	1.00
139_I	170_A	1.125	1.00
155_E	163_A	1.124	1.00
30_L	53_I	1.118	1.00
75_N	100_S	1.098	1.00
94_I	112_N	1.076	1.00
5_R	50_Y	1.057	1.00
115_K	137_A	1.053	1.00
73_I	130_V	1.043	1.00
23_E	156_E	1.036	1.00
24_A	153_A	1.031	1.00
140_R	177_V	1.013	1.00
64_V	67_P	1.013	1.00
6_F	21_L	1.009	1.00
124_K	168_K	1.009	1.00
91_T	110_Y	1.003	1.00
6_F	14_V	0.991	1.00
88_L	110_Y	0.986	1.00
124_K	165_L	0.978	1.00
20_L	132_V	0.977	1.00
163_A	167_I	0.963	1.00
150_L	154_I	0.931	1.00
113_A	137_A	0.926	1.00
37_I	48_E	0.911	0.99
24_A	150_L	0.911	0.99
67_P	87_G	0.906	0.99
88_L	94_I	0.888	0.99
8_G	14_V	0.882	0.99
160_G	163_A	0.872	0.99
67_P	70_L	0.870	0.99
117_A	121_G	0.856	0.99
91_T	109_F	0.854	0.99
74_D	77_L	0.851	0.99
54_S	58_I	0.849	0.99
169_G	173_A	0.848	0.99
118_T	130_V	0.846	0.99
94_I	110_Y	0.842	0.99
103_D	106_W	0.833	0.99
6_F	51_C	0.833	0.99
84_L	87_G	0.829	0.99
24_A	149_S	0.827	0.99
11_G	43_R	0.821	0.99
138_L	142_M	0.807	0.99
4_I	21_L	0.806	0.99
155_E	164_Q	0.800	0.99
18_S	49_A	0.799	0.99
117_A	130_V	0.796	0.99
119_D	122_L	0.791	0.98
3_E	89_K	0.791	0.98
102_P	178_G	0.789	0.98
26_G	32_T	0.788	0.98
23_E	157_E	0.787	0.98
72_V	94_I	0.783	0.98
133_I	173_A	0.780	0.98
86_R	90_D	0.774	0.98
136_G	174_Y	0.774	0.98
104_L	114_T	0.758	0.98
158_F	163_A	0.753	0.98
46_E	74_D	0.752	0.98
17_A	73_I	0.750	0.98
5_R	67_P	0.749	0.98
6_F	71_V	0.744	0.98
14_V	73_I	0.743	0.98
93_T	113_A	0.734	0.98
120_L	124_K	0.724	0.97
12_Q	43_R	0.724	0.97
27_Y	149_S	0.723	0.97
137_A	141_V	0.720	0.97
129_M	169_G	0.714	0.97
64_V	86_R	0.709	0.97
20_L	153_A	0.701	0.97
95_L	117_A	0.701	0.97
115_K	120_L	0.699	0.97
46_E	77_L	0.694	0.97
10_G	39_G	0.691	0.96
36_P	41_E	0.691	0.96
158_F	161_K	0.687	0.96
170_A	174_Y	0.683	0.96
9_R	77_L	0.683	0.96
162_V	165_L	0.681	0.96
15_V	40_A	0.677	0.96
130_V	134_I	0.673	0.96
72_V	96_L	0.672	0.96
70_L	84_L	0.670	0.96
23_E	26_G	0.670	0.96
124_K	129_M	0.666	0.96
126_G	165_L	0.663	0.96
75_N	98_S	0.662	0.95
46_E	84_L	0.661	0.95
57_P	60_V	0.655	0.95
149_S	152_K	0.654	0.95
70_L	88_L	0.653	0.95
149_S	153_A	0.651	0.95
153_A	157_E	0.651	0.95
121_G	130_V	0.651	0.95
10_G	47_I	0.650	0.95
139_I	144_M	0.649	0.95
69_Y	93_T	0.648	0.95
150_L	170_A	0.643	0.95
4_I	69_Y	0.643	0.95
66_E	89_K	0.643	0.95
159_D	163_A	0.635	0.94
15_V	36_P	0.632	0.94
48_E	84_L	0.631	0.94
66_E	90_D	0.631	0.94
107_R	110_Y	0.627	0.94
75_N	79_Q	0.623	0.94
133_I	172_L	0.622	0.94
19_Q	34_S	0.622	0.94
62_S	67_P	0.621	0.94
15_V	47_I	0.620	0.94
50_Y	63_P	0.620	0.94
41_E	44_G	0.618	0.94
73_I	134_I	0.612	0.93
25_A	51_C	0.610	0.93
139_I	147_L	0.608	0.93
37_I	40_A	0.605	0.93
40_A	47_I	0.603	0.93
140_R	178_G	0.602	0.93
99_P	118_T	0.602	0.93
36_P	42_R	0.602	0.93
20_L	157_E	0.598	0.92
34_S	49_A	0.595	0.92
85_F	94_I	0.594	0.92
72_V	84_L	0.593	0.92
154_I	163_A	0.592	0.92
63_P	66_E	0.588	0.92
36_P	49_A	0.588	0.92
7_H	77_L	0.585	0.92
8_G	45_A	0.585	0.92
95_L	137_A	0.582	0.91
142_M	145_P	0.581	0.91
11_G	21_L	0.579	0.91
145_P	150_L	0.577	0.91
37_I	63_P	0.575	0.91
3_E	66_E	0.575	0.91
93_T	141_V	0.572	0.91
19_Q	157_E	0.572	0.91
16_T	20_L	0.571	0.91
34_S	48_E	0.570	0.90
154_I	158_F	0.569	0.90
97_N	116_I	0.567	0.90
42_R	47_I	0.565	0.90
45_A	77_L	0.565	0.90
34_S	51_C	0.562	0.90
33_S	52_R	0.561	0.90
150_L	153_A	0.560	0.90
5_R	62_S	0.558	0.90
97_N	130_V	0.558	0.90
115_K	133_I	0.557	0.89
17_A	135_L	0.557	0.89
154_I	159_D	0.549	0.89
46_E	76_S	0.545	0.88
39_G	42_R	0.543	0.88
42_R	45_A	0.542	0.88
126_G	129_M	0.542	0.88
151_E	154_I	0.541	0.88
3_E	68_D	0.541	0.88
18_S	34_S	0.535	0.88
19_Q	23_E	0.534	0.87
24_A	28_E	0.534	0.87
31_Y	56_T	0.533	0.87
97_N	117_A	0.532	0.87
159_D	162_V	0.532	0.87
3_E	64_V	0.531	0.87
25_A	30_L	0.531	0.87
27_Y	153_A	0.527	0.87
39_G	47_I	0.526	0.87
122_L	128_P	0.524	0.86
136_G	169_G	0.522	0.86
140_R	143_G	0.520	0.86
6_F	73_I	0.516	0.86
6_F	18_S	0.514	0.85
15_V	19_Q	0.512	0.85
10_G	15_V	0.509	0.85
54_S	57_P	0.509	0.85
125_S	129_M	0.507	0.85
15_V	34_S	0.506	0.85
139_I	145_P	0.506	0.85
3_E	67_P	0.505	0.84
43_R	128_P	0.504	0.84
38_Y	44_G	0.502	0.84
28_E	145_P	0.501	0.84
14_V	19_Q	0.500	0.84

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3on3A	2	0.9402	100	0.141	Contact Map
3g2eA	4	0.9837	100	0.148	Contact Map
2raaA	1	0.9293	100	0.158	Contact Map
2c42A	2	0.9946	100	0.202	Contact Map
5c4iB	1	0.9402	100	0.281	Contact Map
1id1A	2	0.7337	49.4	0.924	Contact Map
1dxyA	5	0.8533	49.2	0.924	Contact Map
4xybA	2	0.8913	47.8	0.924	Contact Map
3gvxA	2	0.8533	44.8	0.926	Contact Map
4n18A	2	0.8696	44.4	0.926	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.