Q97V57 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97V57 - Uncharacterized protein

UniProt:	Q97V57	Sequences: MKRILVGYDGSENAERALDFAIELASKFSARLFVVEVIDLTLFYNTGILPPLEATKSLEERAKKDVKRAIEKAKSKGVNAEGITVEGDPANSILQFATDNQIDVIVIGSRGLSKVQRIFLGSVSNKIVQESKVPVVVVK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	139 (132)
Sequences:	19939 (16094)
Seq/√Len:	1400.8

ECOLI - USPF USPE USPG USPC USPD USPA
BACSU - NHAX YXIE
HALSA - Q9HPP5 Q9HRP5 Q9HRD8 Q9HPQ8 Q9HPF7 Q9HP90 Q9HNX9 Q9HMJ0 Q9HHV8 Q9HMI9 Q9HHX5 Q9HHY0 Q9HMU1
SULSO - Q97V57 Q97X90 Q7LXW4 Q97U40

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
33_F	83_I	3.215	1.00
5_L	102_I	2.837	1.00
90_A	126_K	2.774	1.00
3_R	33_F	2.647	1.00
31_R	81_E	2.577	1.00
20_F	136_V	2.529	1.00
3_R	31_R	2.383	1.00
83_I	96_F	2.374	1.00
104_V	136_V	2.328	1.00
33_F	102_I	1.971	1.00
33_F	81_E	1.968	1.00
105_I	133_V	1.951	1.00
107_I	127_I	1.948	1.00
85_V	92_S	1.904	1.00
70_I	82_G	1.901	1.00
125_N	129_Q	1.875	1.00
33_F	96_F	1.822	1.00
97_A	105_I	1.822	1.00
87_G	92_S	1.797	1.00
35_V	96_F	1.766	1.00
6_V	21_A	1.705	1.00
37_V	92_S	1.692	1.00
7_G	107_I	1.652	1.00
7_G	93_I	1.635	1.00
19_D	72_K	1.552	1.00
36_E	62_A	1.532	1.00
24_L	28_F	1.508	1.00
92_S	95_Q	1.503	1.00
70_I	74_K	1.452	1.00
30_A	103_D	1.421	1.00
105_I	131_S	1.393	1.00
63_K	67_K	1.391	1.00
94_L	130_E	1.388	1.00
85_V	96_F	1.387	1.00
15_E	72_K	1.370	1.00
31_R	79_N	1.356	1.00
98_T	132_K	1.355	1.00
6_V	18_L	1.339	1.00
97_A	132_K	1.275	1.00
21_A	25_A	1.273	1.00
126_K	130_E	1.272	1.00
59_E	63_K	1.268	1.00
105_I	127_I	1.201	1.00
89_P	123_V	1.200	1.00
67_K	70_I	1.195	1.00
131_S	135_V	1.188	1.00
35_V	85_V	1.170	1.00
37_V	89_P	1.168	1.00
65_D	69_A	1.109	1.00
20_F	24_L	1.107	1.00
97_A	133_V	1.105	1.00
96_F	102_I	1.087	1.00
115_V	119_F	1.084	1.00
97_A	102_I	1.083	1.00
3_R	103_D	1.081	1.00
67_K	82_G	1.073	1.00
72_K	75_S	1.059	1.00
109_S	137_V	1.055	1.00
26_S	76_K	1.030	1.00
38_I	86_E	1.028	1.00
3_R	102_I	1.023	1.00
94_L	97_A	1.020	1.00
8_Y	69_A	1.011	1.00
4_I	104_V	0.999	1.00
107_I	124_S	0.988	1.00
18_L	34_V	0.979	1.00
23_E	27_K	0.979	1.00
62_A	66_V	0.977	1.00
65_D	68_R	0.972	1.00
62_A	65_D	0.964	1.00
55_T	59_E	0.961	1.00
117_R	125_N	0.958	1.00
21_A	106_V	0.948	1.00
10_G	36_E	0.947	1.00
36_E	65_D	0.939	1.00
67_K	71_E	0.935	1.00
128_V	137_V	0.931	1.00
38_I	84_T	0.929	1.00
34_V	80_A	0.925	1.00
22_I	76_K	0.902	1.00
25_A	32_L	0.895	1.00
28_F	103_D	0.894	1.00
22_I	78_V	0.886	1.00
14_A	17_A	0.881	1.00
11_S	14_A	0.879	1.00
18_L	69_A	0.871	1.00
20_F	138_V	0.870	1.00
20_F	23_E	0.870	1.00
35_V	93_I	0.869	1.00
69_A	72_K	0.860	1.00
112_L	116_Q	0.857	1.00
53_E	57_S	0.857	1.00
62_A	84_T	0.856	1.00
56_K	60_E	0.850	1.00
109_S	124_S	0.843	1.00
8_Y	34_V	0.839	1.00
15_E	68_R	0.838	1.00
124_S	137_V	0.835	1.00
26_S	77_G	0.834	1.00
5_L	96_F	0.834	1.00
20_F	134_P	0.832	1.00
60_E	64_K	0.829	1.00
114_K	117_R	0.820	1.00
8_Y	18_L	0.817	1.00
34_V	69_A	0.813	1.00
22_I	73_A	0.808	1.00
7_G	108_G	0.802	1.00
94_L	127_I	0.801	1.00
66_V	82_G	0.798	1.00
16_R	19_D	0.795	1.00
94_L	131_S	0.794	1.00
21_A	32_L	0.793	1.00
58_L	61_R	0.789	1.00
69_A	73_A	0.788	1.00
15_E	19_D	0.785	1.00
88_D	91_N	0.785	1.00
73_A	80_A	0.784	1.00
18_L	22_I	0.769	1.00
8_Y	15_E	0.765	1.00
115_V	118_I	0.762	1.00
8_Y	17_A	0.761	1.00
5_L	35_V	0.754	1.00
68_R	72_K	0.752	1.00
25_A	30_A	0.749	1.00
5_L	105_I	0.749	1.00
71_E	75_S	0.747	1.00
64_K	68_R	0.745	1.00
61_R	65_D	0.743	1.00
15_E	69_A	0.742	1.00
57_S	61_R	0.740	1.00
106_V	136_V	0.740	1.00
68_R	71_E	0.736	1.00
111_G	120_L	0.726	1.00
90_A	123_V	0.718	1.00
34_V	73_A	0.713	1.00
58_L	62_A	0.712	1.00
101_Q	133_V	0.712	1.00
114_K	118_I	0.708	1.00
93_I	127_I	0.705	1.00
25_A	28_F	0.699	1.00
60_E	63_K	0.699	1.00
11_S	111_G	0.699	1.00
59_E	86_E	0.696	1.00
10_G	65_D	0.690	1.00
24_L	27_K	0.687	1.00
6_V	32_L	0.685	1.00
61_R	64_K	0.680	1.00
57_S	60_E	0.672	1.00
10_G	69_A	0.672	1.00
56_K	59_E	0.670	1.00
38_I	62_A	0.669	1.00
92_S	96_F	0.664	1.00
53_E	56_K	0.656	1.00
107_I	137_V	0.656	1.00
13_N	16_R	0.651	1.00
90_A	94_L	0.648	1.00
71_E	74_K	0.645	1.00
8_Y	14_A	0.642	1.00
54_A	57_S	0.629	1.00
35_V	92_S	0.629	1.00
23_E	26_S	0.626	1.00
24_L	106_V	0.625	1.00
98_T	133_V	0.625	1.00
21_A	30_A	0.614	1.00
120_L	124_S	0.612	1.00
83_I	86_E	0.606	1.00
63_K	82_G	0.603	1.00
91_N	95_Q	0.601	1.00
4_I	25_A	0.597	1.00
22_I	26_S	0.596	1.00
70_I	80_A	0.595	1.00
90_A	130_E	0.595	1.00
4_I	106_V	0.592	1.00
54_A	58_L	0.588	1.00
90_A	127_I	0.587	1.00
50_P	53_E	0.582	1.00
127_I	135_V	0.576	1.00
66_V	70_I	0.575	1.00
49_L	52_L	0.574	1.00
6_V	17_A	0.568	1.00
12_E	15_E	0.561	1.00
110_R	124_S	0.559	1.00
109_S	119_F	0.552	1.00
64_K	67_K	0.552	1.00
106_V	138_V	0.549	1.00
72_K	76_K	0.542	1.00
9_D	14_A	0.535	1.00
55_T	86_E	0.529	1.00
63_K	84_T	0.520	1.00
94_L	126_K	0.520	1.00
24_L	136_V	0.517	1.00
17_A	106_V	0.516	1.00
128_V	135_V	0.516	1.00
42_L	45_N	0.515	1.00
41_T	44_Y	0.511	1.00
16_R	20_F	0.507	1.00
40_L	86_E	0.505	1.00
7_G	89_P	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3s3tA	4	1	99.9	0.127	Contact Map
1mjhA	2	0.9568	99.9	0.135	Contact Map
5ahwA	4	1	99.9	0.135	Contact Map
2gm3A	2	0.8849	99.9	0.14	Contact Map
4wnyA	2	0.8921	99.9	0.14	Contact Map
3idfA	2	0.9784	99.9	0.145	Contact Map
3hgmA	2	0.9928	99.9	0.148	Contact Map
2dumA	2	0.9784	99.9	0.151	Contact Map
3fg9A	3	0.9856	99.9	0.165	Contact Map
3fdxA	2	0.8993	99.9	0.169	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.