Q97V46 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97V46 - Uncharacterized protein

UniProt:	Q97V46	Sequences: MAKSTTTKVGNAIVRTIIYIILYVILSAIVKYIIESLLPSFNIHAVSYESYVQILLALAFGYLIVSGISLIFYYSLLPKYGHPTAAAVRNIMRIIGIGALAASIAGAVAGGAAGVALGGFIGIVIGFASQQVLGQAVAGLFLLVARPFKVNDNVNIVSEDGIVEDVSTLFTTILKADGTRVLIPNNMIIGNKIYLKQTEQQQKPQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	205 (166)
Sequences:	9835 (7099)
Seq/√Len:	551.0

ECOLI - YNAI YBIO YBDG MSCM MSCK MSCS
BACSU - YHDY YFKC YKUT
HALSA - Q9HQ04 Q9HQH2 Q9HNG6
SULSO - Q97V46 Q7LXV0 Q97V08 Q97V66

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
61_G	99_A	4.214	1.00
155_N	160_D	4.009	1.00
164_E	174_L	3.803	1.00
153_N	160_D	3.398	1.00
187_M	191_N	2.859	1.00
130_Q	134_G	2.740	1.00
165_D	172_T	2.432	1.00
155_N	196_K	2.331	1.00
153_N	176_A	2.293	1.00
155_N	194_Y	2.205	1.00
153_N	162_I	2.161	1.00
175_K	181_V	2.132	1.00
73_Y	89_R	2.122	1.00
145_A	169_L	2.120	1.00
181_V	194_Y	1.907	1.00
159_E	192_K	1.847	1.00
47_S	50_S	1.830	1.00
131_Q	134_G	1.797	1.00
157_V	192_K	1.776	1.00
155_N	158_S	1.748	1.00
54_I	107_A	1.727	1.00
152_D	198_T	1.705	1.00
172_T	180_R	1.688	1.00
164_E	180_R	1.676	1.00
69_S	93_R	1.671	1.00
179_T	194_Y	1.666	1.00
171_T	185_N	1.655	1.00
123_I	126_G	1.633	1.00
175_K	179_T	1.631	1.00
95_I	99_A	1.630	1.00
117_L	120_F	1.572	1.00
44_H	48_Y	1.553	1.00
93_R	96_G	1.547	1.00
113_A	116_A	1.533	1.00
187_M	192_K	1.518	1.00
41_F	44_H	1.497	1.00
156_I	188_I	1.473	1.00
62_Y	96_G	1.452	1.00
103_S	107_A	1.443	1.00
161_G	173_I	1.436	1.00
63_L	67_G	1.412	1.00
115_V	119_G	1.387	1.00
58_L	62_Y	1.383	1.00
148_F	171_T	1.378	1.00
54_I	103_S	1.345	1.00
154_V	163_V	1.340	1.00
157_V	191_N	1.326	1.00
187_M	190_G	1.325	1.00
39_P	42_N	1.319	1.00
46_V	49_E	1.305	1.00
65_V	93_R	1.276	1.00
86_A	90_N	1.250	1.00
69_S	89_R	1.248	1.00
180_R	198_T	1.246	1.00
61_G	65_V	1.234	1.00
149_K	198_T	1.215	1.00
57_A	99_A	1.210	1.00
40_S	43_I	1.210	1.00
104_I	109_A	1.201	1.00
148_F	188_I	1.176	1.00
129_S	137_V	1.159	1.00
89_R	93_R	1.148	1.00
99_A	103_S	1.145	1.00
68_I	92_M	1.137	1.00
57_A	106_G	1.134	1.00
145_A	170_F	1.102	1.00
167_S	172_T	1.096	1.00
45_A	48_Y	1.058	1.00
45_A	50_S	1.055	1.00
134_G	186_N	1.055	1.00
121_I	125_I	1.049	1.00
135_Q	186_N	1.046	1.00
65_V	95_I	1.033	1.00
50_S	53_Q	1.033	1.00
75_S	78_P	1.029	1.00
128_A	133_L	1.028	1.00
132_V	138_A	1.023	1.00
174_L	180_R	1.023	1.00
162_I	174_L	1.014	1.00
163_V	173_I	1.004	1.00
112_A	116_A	0.992	1.00
62_Y	66_S	0.989	1.00
44_H	47_S	0.986	1.00
180_R	199_E	0.976	1.00
141_F	189_I	0.975	1.00
53_Q	106_G	0.973	1.00
46_V	50_S	0.964	1.00
170_F	182_L	0.958	1.00
44_H	49_E	0.952	1.00
179_T	196_K	0.950	1.00
154_V	173_I	0.941	1.00
97_I	101_A	0.932	1.00
174_L	178_G	0.924	1.00
121_I	124_V	0.921	1.00
174_L	199_E	0.916	1.00
57_A	61_G	0.913	1.00
38_L	41_F	0.908	1.00
83_P	87_A	0.906	1.00
146_R	149_K	0.898	1.00
162_I	176_A	0.898	1.00
102_A	106_G	0.896	1.00
36_S	39_P	0.892	1.00
138_A	189_I	0.892	1.00
156_I	159_E	0.889	1.00
127_F	130_Q	0.889	1.00
134_G	190_G	0.875	1.00
117_L	122_G	0.868	1.00
59_A	63_L	0.852	1.00
63_L	66_S	0.849	1.00
100_L	104_I	0.848	1.00
157_V	187_M	0.843	1.00
45_A	49_E	0.829	1.00
56_L	60_F	0.829	1.00
138_A	186_N	0.823	1.00
61_G	95_I	0.822	1.00
69_S	73_Y	0.820	1.00
38_L	42_N	0.817	1.00
172_T	182_L	0.816	1.00
125_I	133_L	0.814	1.00
159_E	181_V	0.811	1.00
36_S	40_S	0.811	1.00
164_E	199_E	0.810	1.00
118_G	122_G	0.803	1.00
59_A	62_Y	0.802	1.00
73_Y	77_L	0.796	1.00
148_F	154_V	0.796	1.00
73_Y	85_A	0.793	1.00
40_S	44_H	0.793	1.00
132_V	189_I	0.792	1.00
131_Q	190_G	0.791	1.00
37_L	41_F	0.789	1.00
65_V	69_S	0.789	1.00
120_F	129_S	0.786	1.00
65_V	99_A	0.780	1.00
142_L	148_F	0.776	1.00
130_Q	186_N	0.772	1.00
159_E	194_Y	0.771	1.00
186_N	190_G	0.768	1.00
110_G	113_A	0.766	1.00
160_D	196_K	0.765	1.00
118_G	121_I	0.763	1.00
105_A	110_G	0.760	1.00
96_G	100_L	0.759	1.00
156_I	183_I	0.759	1.00
42_N	46_V	0.755	1.00
76_L	85_A	0.751	1.00
131_Q	186_N	0.747	1.00
176_A	196_K	0.744	1.00
68_I	71_I	0.742	1.00
53_Q	57_A	0.742	1.00
132_V	141_F	0.738	1.00
58_L	61_G	0.738	1.00
167_S	170_F	0.736	1.00
54_I	58_L	0.729	1.00
116_A	119_G	0.726	1.00
65_V	96_G	0.725	1.00
39_P	44_H	0.719	1.00
71_I	75_S	0.712	1.00
86_A	165_D	0.710	1.00
120_F	124_V	0.708	1.00
43_I	46_V	0.706	1.00
160_D	176_A	0.705	1.00
121_I	128_A	0.705	1.00
119_G	123_I	0.705	1.00
153_N	196_K	0.704	1.00
84_T	87_A	0.704	1.00
105_A	111_G	0.701	1.00
144_V	147_P	0.700	1.00
82_H	86_A	0.699	1.00
76_L	79_K	0.694	1.00
52_V	56_L	0.692	1.00
156_I	192_K	0.688	1.00
81_G	146_R	0.688	1.00
178_G	200_Q	0.685	1.00
81_G	84_T	0.684	1.00
54_I	62_Y	0.683	1.00
72_F	75_S	0.676	1.00
42_N	45_A	0.674	1.00
82_H	85_A	0.668	1.00
55_L	66_S	0.667	1.00
56_L	59_A	0.667	1.00
83_P	86_A	0.665	1.00
42_N	50_S	0.665	1.00
101_A	105_A	0.664	1.00
141_F	145_A	0.662	1.00
99_A	102_A	0.660	1.00
145_A	172_T	0.656	1.00
90_N	165_D	0.655	1.00
37_L	40_S	0.652	1.00
60_F	63_L	0.650	1.00
90_N	93_R	0.645	1.00
109_A	113_A	0.644	1.00
36_S	42_N	0.643	1.00
175_K	194_Y	0.642	1.00
102_A	105_A	0.642	1.00
57_A	60_F	0.635	1.00
83_P	143_L	0.631	1.00
142_L	185_N	0.630	1.00
53_Q	66_S	0.626	1.00
123_I	131_Q	0.625	1.00
41_F	45_A	0.619	1.00
74_Y	77_L	0.617	1.00
54_I	65_V	0.611	1.00
51_Y	55_L	0.610	1.00
121_I	126_G	0.609	1.00
141_F	169_L	0.609	1.00
117_L	124_V	0.605	1.00
81_G	85_A	0.599	1.00
49_E	52_V	0.595	1.00
115_V	124_V	0.591	1.00
43_I	47_S	0.587	1.00
66_S	70_L	0.586	1.00
83_P	149_K	0.585	1.00
68_I	72_F	0.575	0.99
52_V	55_L	0.575	0.99
44_H	50_S	0.573	0.99
60_F	64_I	0.568	0.99
125_I	137_V	0.567	0.99
154_V	188_I	0.566	0.99
159_E	183_I	0.565	0.99
67_G	70_L	0.564	0.99
122_G	128_A	0.562	0.99
117_L	121_I	0.562	0.99
68_I	95_I	0.560	0.99
131_Q	135_Q	0.557	0.99
57_A	102_A	0.557	0.99
71_I	74_Y	0.553	0.99
58_L	103_S	0.551	0.99
104_I	108_V	0.547	0.99
75_S	79_K	0.545	0.99
98_G	102_A	0.545	0.99
82_H	150_V	0.544	0.99
176_A	201_Q	0.543	0.99
67_G	71_I	0.540	0.99
55_L	59_A	0.537	0.99
86_A	89_R	0.534	0.99
120_F	123_I	0.526	0.99
148_F	198_T	0.520	0.99
132_V	178_G	0.518	0.99
184_P	187_M	0.516	0.99
111_G	114_G	0.514	0.99
151_N	162_I	0.514	0.99
155_N	159_E	0.513	0.99
156_I	191_N	0.512	0.99
74_Y	78_P	0.511	0.99
150_V	165_D	0.511	0.99
171_T	188_I	0.505	0.99
119_G	130_Q	0.502	0.99
81_G	149_K	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
5ajiA	3	0.8146	100	0.248	Contact Map
4hw9A	3	0.7707	100	0.264	Contact Map
3udcA	3	0.7805	100	0.299	Contact Map
3mlqE	1	0.1902	30.3	0.927	Contact Map
3askA	1	0.2683	29.8	0.927	Contact Map
1nz9A	1	0.2341	23.6	0.93	Contact Map
4lz6A	1	0.6829	18	0.934	Contact Map
4l5gA	1	0.3024	15.9	0.936	Contact Map
2mi6A	1	0.2537	14.5	0.937	Contact Map
4kbmB	1	0.2829	12.1	0.939	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.