Q97V11 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97V11 - Uncharacterized protein

UniProt:	Q97V11	Sequences: MRLTNRRDFLKLLLISSSLLVLGRLSISEMQHAQNGLTPFGSWYVVQYSQIVPDIMLNNYVLTVDGEIENPLKLTYQDLLNMPSIEVKDTIQCVSDPYFLRANVLWKGIPLSYVIDMVKPKSNVIKVVGYGADGYTADLPIEKAKEPNVLIAYMADDKPLPQVHGYPVRLVVPGWWGYTYVKWLVRLHFTSKNILGYWESLGYPDYAKK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	209 (177)
Sequences:	4143 (2461)
Seq/√Len:	184.9

ECOLI - YEDY
BACSU - YUIH
HALSA - Q9HQN1
SULSO - Q97V11 Q97U24

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
84_S	153_Y	3.666	1.00
75_T	78_D	3.317	1.00
110_P	113_Y	3.196	1.00
86_E	107_K	3.191	1.00
69_E	119_K	3.065	1.00
65_D	188_H	3.040	1.00
69_E	121_K	2.879	1.00
65_D	186_R	2.877	1.00
82_M	117_M	2.661	1.00
129_G	187_L	2.535	1.00
130_Y	186_R	2.484	1.00
61_V	73_K	2.415	1.00
107_K	154_M	2.350	1.00
63_T	73_K	2.299	1.00
72_L	118_V	2.157	1.00
151_I	168_V	2.138	1.00
116_D	145_K	2.110	1.00
113_Y	116_D	2.067	1.00
86_E	105_L	2.055	1.00
115_I	189_F	2.042	1.00
91_I	177_G	2.029	1.00
67_E	191_S	1.959	1.00
56_M	59_N	1.951	1.00
128_V	190_T	1.940	1.00
127_V	189_F	1.846	1.00
88_K	105_L	1.842	1.00
139_L	172_V	1.835	1.00
114_V	151_I	1.819	1.00
105_L	157_D	1.809	1.00
104_V	155_A	1.806	1.00
67_E	121_K	1.790	1.00
152_A	171_V	1.788	1.00
112_S	116_D	1.778	1.00
84_S	107_K	1.731	1.00
123_N	191_S	1.728	1.00
132_A	185_V	1.682	1.00
128_V	188_H	1.611	1.00
70_N	119_K	1.576	1.00
85_I	110_P	1.560	1.00
111_L	144_A	1.549	1.00
72_L	117_M	1.499	1.00
130_Y	188_H	1.498	1.00
63_T	186_R	1.474	1.00
129_G	184_L	1.468	1.00
80_L	153_Y	1.464	1.00
124_V	189_F	1.464	1.00
43_W	104_V	1.456	1.00
90_T	103_N	1.414	1.00
151_I	184_L	1.411	1.00
109_I	114_V	1.401	1.00
68_I	71_P	1.397	1.00
202_G	205_D	1.395	1.00
76_Y	80_L	1.384	1.00
67_E	123_N	1.382	1.00
81_N	117_M	1.381	1.00
154_M	159_P	1.368	1.00
74_L	117_M	1.329	1.00
129_G	170_L	1.310	1.00
58_N	77_Q	1.306	1.00
84_S	154_M	1.303	1.00
149_V	172_V	1.303	1.00
127_V	144_A	1.296	1.00
78_D	81_N	1.226	1.00
172_V	180_Y	1.222	1.00
112_S	147_P	1.219	1.00
195_L	200_S	1.198	1.00
146_E	149_V	1.183	1.00
91_I	180_Y	1.182	1.00
37_L	88_K	1.155	1.00
111_L	187_L	1.152	1.00
60_Y	76_Y	1.126	1.00
82_M	109_I	1.118	1.00
79_L	168_V	1.089	1.00
196_G	199_E	1.087	1.00
143_K	175_W	1.068	1.00
37_L	155_A	1.066	1.00
33_A	37_L	1.027	1.00
66_G	71_P	1.025	1.00
43_W	102_A	1.023	1.00
87_V	150_L	1.016	1.00
115_I	120_P	1.005	0.99
85_I	150_L	1.005	0.99
57_L	76_Y	1.001	0.99
80_L	154_M	1.000	0.99
141_I	189_F	0.997	0.99
40_F	161_P	0.996	0.99
137_A	181_V	0.996	0.99
143_K	174_G	0.993	0.99
137_A	178_Y	0.991	0.99
107_K	153_Y	0.988	0.99
43_W	155_A	0.984	0.99
83_P	110_P	0.980	0.99
125_I	191_S	0.967	0.99
195_L	199_E	0.962	0.99
85_I	113_Y	0.960	0.99
105_L	156_D	0.957	0.99
83_P	113_Y	0.953	0.99
68_I	189_F	0.949	0.99
64_V	68_I	0.944	0.99
77_Q	80_L	0.938	0.99
67_E	124_V	0.937	0.99
137_A	179_T	0.910	0.99
120_P	189_F	0.899	0.99
109_I	153_Y	0.893	0.99
47_Q	52_V	0.890	0.99
55_I	132_A	0.885	0.99
64_V	72_L	0.883	0.99
40_F	104_V	0.878	0.99
60_Y	168_V	0.877	0.99
143_K	206_Y	0.861	0.98
58_N	76_Y	0.855	0.98
62_L	168_V	0.851	0.98
188_H	194_I	0.843	0.98
111_L	170_L	0.843	0.98
54_D	162_Q	0.840	0.98
120_P	141_I	0.828	0.98
155_A	164_H	0.824	0.98
45_V	163_V	0.820	0.98
74_L	118_V	0.820	0.98
91_I	104_V	0.818	0.98
131_G	181_V	0.816	0.98
170_L	181_V	0.815	0.98
34_Q	158_K	0.812	0.98
52_V	163_V	0.806	0.97
129_G	181_V	0.805	0.97
46_V	49_S	0.799	0.97
32_H	37_L	0.799	0.97
84_S	109_I	0.792	0.97
43_W	183_W	0.791	0.97
32_H	36_G	0.790	0.97
88_K	103_N	0.785	0.97
104_V	156_D	0.784	0.97
94_V	178_Y	0.781	0.97
33_A	36_G	0.780	0.97
171_V	180_Y	0.769	0.97
140_P	143_K	0.761	0.96
77_Q	81_N	0.759	0.96
80_L	159_P	0.755	0.96
155_A	161_P	0.754	0.96
151_I	170_L	0.751	0.96
153_Y	159_P	0.750	0.96
153_Y	168_V	0.749	0.96
170_L	184_L	0.743	0.96
68_I	118_V	0.734	0.96
128_V	199_E	0.724	0.95
109_I	113_Y	0.719	0.95
63_T	71_P	0.719	0.95
79_L	109_I	0.717	0.95
68_I	124_V	0.713	0.95
47_Q	183_W	0.711	0.95
68_I	72_L	0.708	0.95
96_D	99_F	0.705	0.95
32_H	35_N	0.697	0.94
127_V	187_L	0.680	0.93
113_Y	117_M	0.679	0.93
110_P	150_L	0.678	0.93
161_P	164_H	0.678	0.93
82_M	113_Y	0.674	0.93
152_A	170_L	0.670	0.93
201_L	204_P	0.663	0.93
57_L	166_Y	0.661	0.92
136_T	200_S	0.660	0.92
92_Q	137_A	0.654	0.92
178_Y	199_E	0.654	0.92
72_L	78_D	0.650	0.92
126_K	138_D	0.645	0.92
197_Y	202_G	0.645	0.92
143_K	146_E	0.644	0.91
126_K	194_I	0.643	0.91
128_V	194_I	0.642	0.91
146_E	174_G	0.639	0.91
69_E	72_L	0.637	0.91
65_D	71_P	0.635	0.91
74_L	78_D	0.634	0.91
64_V	74_L	0.634	0.91
137_A	199_E	0.629	0.90
102_A	155_A	0.629	0.90
40_F	158_K	0.625	0.90
54_D	58_N	0.624	0.90
52_V	162_Q	0.621	0.90
94_V	176_W	0.619	0.90
107_K	110_P	0.619	0.90
129_G	135_Y	0.615	0.90
130_Y	136_T	0.613	0.89
176_W	179_T	0.609	0.89
109_I	151_I	0.608	0.89
115_I	145_K	0.608	0.89
152_A	168_V	0.608	0.89
190_T	194_I	0.607	0.89
31_Q	34_Q	0.607	0.89
95_S	178_Y	0.603	0.89
79_L	153_Y	0.601	0.88
91_I	171_V	0.598	0.88
40_F	155_A	0.597	0.88
143_K	149_V	0.596	0.88
150_L	171_V	0.595	0.88
128_V	136_T	0.595	0.88
29_E	33_A	0.592	0.88
111_L	149_V	0.591	0.88
126_K	193_N	0.591	0.88
66_G	124_V	0.590	0.88
175_W	179_T	0.590	0.88
104_V	171_V	0.589	0.87
111_L	115_I	0.585	0.87
38_T	161_P	0.583	0.87
90_T	95_S	0.581	0.87
65_D	68_I	0.581	0.87
102_A	177_G	0.581	0.87
196_G	200_S	0.578	0.86
184_L	187_L	0.577	0.86
62_L	74_L	0.571	0.86
111_L	189_F	0.570	0.86
67_E	71_P	0.566	0.85
46_V	95_S	0.566	0.85
144_A	149_V	0.565	0.85
74_L	82_M	0.558	0.84
128_V	195_L	0.557	0.84
40_F	43_W	0.554	0.84
94_V	198_W	0.553	0.84
148_N	174_G	0.552	0.84
135_Y	178_Y	0.551	0.84
65_D	130_Y	0.551	0.84
115_I	118_V	0.542	0.83
90_T	100_L	0.541	0.83
62_L	151_I	0.541	0.83
109_I	168_V	0.541	0.83
27_I	32_H	0.540	0.83
197_Y	201_L	0.538	0.82
170_L	187_L	0.537	0.82
69_E	122_S	0.536	0.82
158_K	161_P	0.533	0.82
55_I	133_D	0.531	0.81
193_N	199_E	0.531	0.81
62_L	79_L	0.530	0.81
102_A	106_W	0.529	0.81
138_D	178_Y	0.529	0.81
100_L	179_T	0.528	0.81
29_E	32_H	0.528	0.81
67_E	190_T	0.528	0.81
95_S	175_W	0.528	0.81
74_L	114_V	0.526	0.81
92_Q	95_S	0.524	0.81
152_A	160_L	0.524	0.81
95_S	99_F	0.519	0.80
69_E	127_V	0.518	0.80
47_Q	53_P	0.517	0.80
61_V	75_T	0.515	0.79
62_L	186_R	0.515	0.79
89_D	171_V	0.513	0.79
142_E	145_K	0.512	0.79
31_Q	37_L	0.511	0.79
43_W	106_W	0.510	0.79
86_E	157_D	0.509	0.79
114_V	168_V	0.508	0.79
27_I	31_Q	0.508	0.79
138_D	199_E	0.508	0.79
94_V	101_R	0.507	0.78
49_S	180_Y	0.506	0.78
99_F	179_T	0.506	0.78
192_K	195_L	0.505	0.78
43_W	198_W	0.505	0.78
47_Q	51_I	0.504	0.78
139_L	175_W	0.502	0.78
56_M	134_G	0.500	0.77
125_I	141_I	0.500	0.77
117_M	120_P	0.500	0.77

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2a9dA	2	0.9856	100	0.187	Contact Map
2blfA	1	1	100	0.19	Contact Map
1ogpA	4	0.9856	100	0.19	Contact Map
1soxA	2	0.9952	100	0.19	Contact Map
2biiA	2	0.8947	100	0.216	Contact Map
2bihA	2	0.9713	100	0.216	Contact Map
4pw3A	2	0.9426	100	0.225	Contact Map
2xtsA	2	0.9665	100	0.234	Contact Map
1xdyA	3	0.9187	100	0.249	Contact Map
2pq4B	1	0.1675	36.9	0.951	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.