Q97UX9 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97UX9 - Uncharacterized protein

UniProt:	Q97UX9	Sequences: MDSQNYDIEKILQRYDSDYVFHYLGVKILEIKEGYAKTQIPFKKELTRRGNILNGGMIVASIDYTGGLAVLSINDGMDQVTQELKVNFLEPMYRGPFTVEANVIRKGRTAVTVEITFKDVEGSLGAIGLGTWYIIRDKKINMNVQPQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	147 (122)
Sequences:	6130 (4175)
Seq/√Len:	378.0

ECOLI - PAAI YIGI MENI ENTH
BACSU - COMA2
HALSA - Y1336
SULSO - Q97UX9 Y1253 Y2140 Q97VK2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
39_Q	96_P	3.403	1.00
29_L	39_Q	3.098	1.00
82_Q	110_A	2.657	1.00
37_K	100_E	2.595	1.00
100_E	118_K	2.322	1.00
30_E	37_K	2.311	1.00
27_K	39_Q	2.247	1.00
38_T	65_T	2.237	1.00
30_E	35_Y	2.205	1.00
59_V	84_L	2.065	1.00
32_K	35_Y	2.043	1.00
116_T	124_L	1.928	1.00
66_G	115_I	1.895	1.00
65_T	99_V	1.885	1.00
35_Y	102_N	1.819	1.00
35_Y	100_E	1.811	1.00
40_I	57_M	1.799	1.00
90_E	123_S	1.771	1.00
39_Q	98_T	1.761	1.00
37_K	98_T	1.761	1.00
70_V	111_V	1.755	1.00
119_D	123_S	1.708	1.00
62_I	128_G	1.669	1.00
114_E	127_I	1.666	1.00
104_I	114_E	1.610	1.00
102_N	114_E	1.551	1.00
102_N	116_T	1.537	1.00
41_P	96_P	1.515	1.00
103_V	106_K	1.504	1.00
66_G	130_G	1.477	1.00
62_I	115_I	1.457	1.00
59_V	86_V	1.455	1.00
83_E	87_N	1.448	1.00
29_L	37_K	1.435	1.00
20_V	57_M	1.407	1.00
77_M	136_R	1.403	1.00
92_M	125_G	1.353	1.00
23_Y	45_E	1.322	1.00
104_I	127_I	1.319	1.00
70_V	132_W	1.287	1.00
34_G	72_S	1.262	1.00
73_I	106_K	1.253	1.00
42_F	53_L	1.239	1.00
43_K	46_L	1.228	1.00
116_T	127_I	1.205	1.00
58_I	126_A	1.194	1.00
59_V	88_F	1.191	1.00
20_V	60_A	1.171	1.00
95_G	120_V	1.159	1.00
62_I	117_F	1.151	1.00
105_R	110_A	1.142	1.00
118_K	122_G	1.132	1.00
86_V	126_A	1.119	1.00
44_K	47_T	1.119	1.00
111_V	134_I	1.106	1.00
92_M	97_F	1.105	1.00
53_L	97_F	1.096	1.00
118_K	124_L	1.083	1.00
99_V	115_I	1.073	1.00
114_E	129_L	1.060	1.00
61_S	99_V	1.027	1.00
89_L	127_I	1.019	1.00
27_K	96_P	0.989	1.00
96_P	120_V	0.988	1.00
110_A	133_Y	0.983	1.00
58_I	117_F	0.980	1.00
52_I	80_V	0.964	1.00
40_I	61_S	0.963	1.00
85_K	129_L	0.957	1.00
73_I	103_V	0.948	1.00
63_D	81_T	0.945	1.00
26_V	38_T	0.943	1.00
70_V	113_V	0.942	1.00
56_G	60_A	0.935	1.00
87_N	131_T	0.916	1.00
69_A	103_V	0.911	1.00
58_I	125_G	0.890	1.00
109_T	133_Y	0.889	1.00
74_N	77_M	0.883	1.00
105_R	112_T	0.880	1.00
95_G	119_D	0.869	1.00
27_K	41_P	0.857	1.00
69_A	101_A	0.855	1.00
98_T	120_V	0.855	1.00
80_V	135_I	0.847	1.00
98_T	118_K	0.826	1.00
69_A	113_V	0.823	1.00
66_G	132_W	0.821	1.00
100_E	116_T	0.818	1.00
53_L	92_M	0.807	1.00
103_V	113_V	0.806	1.00
83_E	129_L	0.804	1.00
89_L	124_L	0.798	1.00
31_I	72_S	0.797	1.00
21_F	64_Y	0.791	1.00
84_L	88_F	0.779	1.00
112_T	131_T	0.766	1.00
83_E	131_T	0.761	1.00
99_V	117_F	0.761	1.00
97_F	117_F	0.758	1.00
58_I	88_F	0.751	1.00
87_N	112_T	0.748	1.00
19_Y	22_H	0.746	1.00
33_E	73_I	0.743	1.00
89_L	105_R	0.741	1.00
46_L	57_M	0.734	1.00
97_F	125_G	0.731	1.00
55_G	88_F	0.728	1.00
41_P	46_L	0.716	1.00
29_L	96_P	0.714	1.00
24_L	60_A	0.714	1.00
28_I	38_T	0.711	1.00
52_I	91_P	0.706	1.00
49_R	67_G	0.705	1.00
71_L	78_D	0.698	0.99
98_T	122_G	0.688	0.99
47_T	94_R	0.686	0.99
54_N	64_Y	0.684	0.99
84_L	128_G	0.682	0.99
71_L	79_Q	0.679	0.99
34_G	73_I	0.672	0.99
100_E	122_G	0.668	0.99
62_I	86_V	0.666	0.99
66_G	113_V	0.662	0.99
115_I	130_G	0.660	0.99
90_E	105_R	0.657	0.99
42_F	46_L	0.657	0.99
81_T	84_L	0.655	0.99
34_G	69_A	0.654	0.99
42_F	47_T	0.654	0.99
63_D	67_G	0.649	0.99
79_Q	134_I	0.649	0.99
66_G	128_G	0.648	0.99
89_L	112_T	0.645	0.99
36_A	69_A	0.644	0.99
58_I	92_M	0.640	0.99
64_Y	68_L	0.634	0.99
34_G	103_V	0.631	0.99
26_V	40_I	0.627	0.99
16_D	22_H	0.627	0.99
17_S	22_H	0.626	0.99
21_F	68_L	0.622	0.99
25_G	45_E	0.618	0.99
65_T	101_A	0.615	0.99
81_T	132_W	0.613	0.99
67_G	132_W	0.608	0.99
106_K	111_V	0.603	0.98
81_T	130_G	0.601	0.98
25_G	43_K	0.601	0.98
101_A	115_I	0.600	0.98
59_V	128_G	0.588	0.98
124_L	127_I	0.583	0.98
92_M	119_D	0.582	0.98
77_M	134_I	0.577	0.98
101_A	113_V	0.576	0.98
106_K	134_I	0.570	0.98
46_L	53_L	0.565	0.98
22_H	45_E	0.564	0.98
115_I	128_G	0.559	0.97
28_I	68_L	0.559	0.97
39_Q	120_V	0.559	0.97
98_T	119_D	0.557	0.97
108_R	136_R	0.556	0.97
53_L	58_I	0.555	0.97
79_Q	132_W	0.553	0.97
58_I	63_D	0.547	0.97
112_T	127_I	0.544	0.97
90_E	133_Y	0.542	0.97
29_L	38_T	0.542	0.97
36_A	72_S	0.534	0.97
111_V	132_W	0.529	0.96
82_Q	133_Y	0.523	0.96
50_G	80_V	0.520	0.96
86_V	128_G	0.520	0.96
78_D	135_I	0.516	0.96
85_K	131_T	0.515	0.96
80_V	133_Y	0.512	0.96
87_N	129_L	0.507	0.96
20_V	24_L	0.504	0.95
21_F	26_V	0.504	0.95
23_Y	57_M	0.501	0.95
26_V	60_A	0.500	0.95
20_V	23_Y	0.500	0.95

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3e8pA	3	0.9184	99.9	0.33	Contact Map
3f1tA	2	0.898	99.9	0.334	Contact Map
4rmmA	2	0.8912	99.9	0.335	Contact Map
3hduA	4	0.9184	99.9	0.338	Contact Map
1t82A	2	0.898	99.9	0.338	Contact Map
1sh8A	2	0.932	99.9	0.34	Contact Map
3gekA	3	0.8231	99.9	0.342	Contact Map
3e29A	3	0.9048	99.9	0.354	Contact Map
3e1eA	3	0.932	99.9	0.357	Contact Map
4qd8A	3	0.9184	99.9	0.359	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.