Q97UX4 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97UX4 - Uncharacterized protein

UniProt:	Q97UX4	Sequences: MILKDENMAKVLFLIMSGDEKFDLAMRMAYNSVKNKRYEDVKVIYFGPSQKKLTQLDGDMKNMFQELLQNKIVDSACIGVAQAMNIKPHLENLGVSLMPAGERVSYYVNQGYEVITF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	117 (108)
Sequences:	120 (109)
Seq/√Len:	10.5

SULSO - Q97UX4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
82_Q	87_K	3.026	0.94
19_D	48_P	2.906	0.93
78_I	99_P	2.842	0.92
37_R	99_P	2.640	0.88
43_V	108_V	2.607	0.88
37_R	97_L	2.454	0.84
15_I	46_F	2.334	0.81
44_I	100_A	2.318	0.80
13_F	29_A	2.138	0.75
31_N	37_R	1.941	0.67
40_D	112_Y	1.925	0.66
20_E	49_S	1.895	0.65
18_G	49_S	1.891	0.65
20_E	48_P	1.856	0.63
102_E	106_Y	1.737	0.58
57_D	66_E	1.637	0.53
78_I	82_Q	1.607	0.52
23_D	83_A	1.584	0.51
31_N	99_P	1.571	0.50
10_K	40_D	1.570	0.50
97_L	115_I	1.560	0.50
100_A	104_V	1.558	0.50
38_Y	105_S	1.528	0.48
100_A	103_R	1.524	0.48
45_Y	54_T	1.508	0.47
24_L	104_V	1.484	0.46
10_K	42_K	1.476	0.46
106_Y	110_Q	1.411	0.43
37_R	78_I	1.397	0.42
54_T	60_M	1.362	0.40
48_P	112_Y	1.315	0.38
60_M	114_V	1.313	0.38
31_N	97_L	1.292	0.37
44_I	51_K	1.286	0.37
69_Q	96_S	1.265	0.36
9_A	92_N	1.236	0.35
44_I	104_V	1.212	0.34
14_L	84_M	1.165	0.32
12_L	100_A	1.141	0.31
31_N	101_G	1.134	0.31
58_G	62_N	1.118	0.30
42_K	107_Y	1.111	0.30
9_A	39_E	1.108	0.30
15_I	27_R	1.102	0.29
44_I	92_N	1.094	0.29
26_M	78_I	1.092	0.29
33_V	72_I	1.079	0.28
15_I	38_Y	1.076	0.28
48_P	84_M	1.058	0.28
16_M	24_L	1.057	0.28
46_F	104_V	1.051	0.27
18_G	43_V	1.044	0.27
46_F	80_V	1.040	0.27
51_K	64_F	1.010	0.26
37_R	108_V	0.986	0.25
10_K	115_I	0.979	0.25
28_M	109_N	0.972	0.25
100_A	107_Y	0.967	0.24
82_Q	99_P	0.964	0.24
34_K	40_D	0.957	0.24
10_K	67_L	0.956	0.24
82_Q	90_L	0.954	0.24
13_F	28_M	0.945	0.24
40_D	110_Q	0.945	0.24
24_L	48_P	0.943	0.24
28_M	105_S	0.933	0.23
19_D	54_T	0.932	0.23
15_I	28_M	0.915	0.23
43_V	105_S	0.915	0.23
26_M	99_P	0.909	0.22
28_M	37_R	0.899	0.22
36_K	57_D	0.897	0.22
73_V	78_I	0.892	0.22
22_F	25_A	0.887	0.22
22_F	96_S	0.884	0.22
21_K	48_P	0.884	0.22
8_M	12_L	0.874	0.21
29_A	62_N	0.869	0.21
9_A	54_T	0.851	0.21
35_N	58_G	0.849	0.21
80_V	93_L	0.844	0.20
58_G	89_H	0.842	0.20
13_F	38_Y	0.836	0.20
32_S	101_G	0.825	0.20
15_I	104_V	0.825	0.20
89_H	110_Q	0.821	0.20
30_Y	70_N	0.817	0.20
15_I	25_A	0.814	0.19
12_L	114_V	0.811	0.19
48_P	54_T	0.806	0.19
14_L	116_T	0.801	0.19
50_Q	86_I	0.798	0.19
43_V	83_A	0.783	0.19
100_A	114_V	0.767	0.18
20_E	59_D	0.759	0.18
12_L	112_Y	0.758	0.18
65_Q	92_N	0.756	0.18
15_I	80_V	0.739	0.17
40_D	57_D	0.739	0.17
15_I	29_A	0.733	0.17
35_N	44_I	0.732	0.17
59_D	111_G	0.731	0.17
36_K	111_G	0.730	0.17
14_L	104_V	0.707	0.17
17_S	63_M	0.706	0.16
60_M	69_Q	0.705	0.16
90_L	97_L	0.705	0.16
17_S	107_Y	0.701	0.16
19_D	108_V	0.699	0.16
53_L	106_Y	0.696	0.16
43_V	60_M	0.691	0.16
55_Q	89_H	0.689	0.16
14_L	81_A	0.687	0.16
11_V	33_V	0.683	0.16
16_M	104_V	0.669	0.16
20_E	98_M	0.668	0.16
14_L	113_E	0.653	0.15
39_E	78_I	0.650	0.15
95_V	115_I	0.649	0.15
29_A	66_E	0.644	0.15
30_Y	67_L	0.634	0.15
22_F	45_Y	0.621	0.14
38_Y	109_N	0.620	0.14
32_S	109_N	0.617	0.14
28_M	80_V	0.613	0.14
33_V	85_N	0.606	0.14
31_N	105_S	0.606	0.14
107_Y	114_V	0.605	0.14
82_Q	111_G	0.596	0.14
70_N	102_E	0.596	0.14
89_H	92_N	0.586	0.14
29_A	51_K	0.582	0.14
25_A	46_F	0.579	0.13
14_L	69_Q	0.578	0.13
14_L	24_L	0.577	0.13
87_K	115_I	0.577	0.13
14_L	34_K	0.576	0.13
16_M	61_K	0.573	0.13
61_K	65_Q	0.573	0.13
34_K	78_I	0.568	0.13
107_Y	112_Y	0.564	0.13
11_V	38_Y	0.558	0.13
30_Y	33_V	0.558	0.13
22_F	59_D	0.557	0.13
26_M	69_Q	0.550	0.13
18_G	92_N	0.550	0.13
31_N	79_G	0.546	0.13
99_P	107_Y	0.544	0.13
67_L	111_G	0.541	0.13
26_M	37_R	0.541	0.13
36_K	58_G	0.539	0.13
47_G	77_C	0.539	0.13
41_V	57_D	0.536	0.13
45_Y	50_Q	0.532	0.12
75_S	78_I	0.529	0.12
17_S	74_D	0.528	0.12
71_K	104_V	0.527	0.12
27_R	79_G	0.524	0.12
87_K	96_S	0.516	0.12
13_F	37_R	0.516	0.12
81_A	100_A	0.510	0.12
23_D	63_M	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2fb6A	3	0.9744	99.9	0.504	Contact Map
1jx7A	5	0.9316	99.4	0.682	Contact Map
1l1sA	3	0.9316	99.4	0.683	Contact Map
2pd2A	3	0.9145	99.4	0.691	Contact Map
3mc3A	3	0.8291	99.2	0.706	Contact Map
2qs7A	3	0.8974	98.6	0.771	Contact Map
2hy5B	1	0.9145	98.6	0.773	Contact Map
2hy5A	2	0.8889	98.6	0.774	Contact Map
2d1pB	1	0.906	98.5	0.777	Contact Map
2d1pA	2	0.9145	97.9	0.81	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.