Q97UW9 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97UW9 - Uncharacterized protein

UniProt:	Q97UW9	Sequences: MSLNEIRDKMQKEISQSLLMLDNAIKTTKLPIVNEQKTNNPLWIDVREIDLRYQIPVKRIFKFFEGLREGKILATKCPKCGSIYFPPQDDCPKCKISNLEWIEMPKEGEIVAYTVVNVKPPSFSHYQDYIVGIARMSNGVNVLGWVRAKEVRVGMKVKLEVIERKPEGYLTYELVPVG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	178 (139)
Sequences:	406 (261)
Seq/√Len:	22.2

HALSA - Q9HRI9
SULSO - Q97UW9 Q97WQ4 Q97WQ5 Q7LXW3 Q97VJ8 Q97UA6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
77_C	91_C	4.656	1.00
77_C	80_C	4.477	1.00
71_K	103_E	4.073	1.00
80_C	91_C	4.072	1.00
91_C	94_C	3.775	1.00
80_C	94_C	3.627	1.00
77_C	94_C	3.536	1.00
137_S	156_K	3.360	1.00
110_I	157_V	3.245	1.00
170_L	173_E	2.981	0.99
33_V	37_K	2.832	0.99
107_E	158_K	2.775	0.99
70_G	163_E	2.562	0.98
107_E	137_S	2.535	0.98
63_F	66_G	2.462	0.98
61_F	65_E	2.276	0.97
73_L	103_E	2.263	0.96
65_E	69_E	2.260	0.96
108_G	157_V	2.213	0.96
105_P	137_S	2.075	0.94
79_K	98_N	2.053	0.94
110_I	151_V	1.923	0.91
64_F	161_V	1.923	0.91
72_I	85_F	1.809	0.89
110_I	132_G	1.640	0.83
102_I	109_E	1.605	0.82
77_C	84_Y	1.588	0.81
69_E	142_V	1.521	0.78
113_Y	153_V	1.495	0.77
34_N	37_K	1.493	0.77
108_G	144_G	1.339	0.68
38_T	41_P	1.338	0.68
66_G	73_L	1.234	0.62
96_I	150_E	1.228	0.61
66_G	69_E	1.220	0.61
62_K	87_P	1.210	0.60
87_P	92_P	1.152	0.56
70_G	168_G	1.148	0.56
73_L	101_W	1.094	0.53
144_G	172_Y	1.074	0.51
48_E	132_G	1.072	0.51
68_R	113_Y	1.031	0.48
140_V	161_V	1.019	0.47
107_E	142_V	1.002	0.46
151_V	157_V	1.001	0.46
77_C	88_Q	0.994	0.46
75_T	101_W	0.989	0.45
41_P	49_I	0.981	0.45
33_V	36_Q	0.976	0.44
62_K	101_W	0.970	0.44
76_K	82_S	0.961	0.43
128_D	141_N	0.958	0.43
106_K	138_N	0.950	0.43
72_I	134_A	0.941	0.42
74_A	83_I	0.937	0.42
82_S	93_K	0.935	0.42
52_R	130_I	0.930	0.41
152_R	170_L	0.929	0.41
36_Q	39_N	0.919	0.41
69_E	81_G	0.915	0.40
65_E	111_V	0.908	0.40
58_K	148_A	0.907	0.40
98_N	168_G	0.904	0.40
116_V	140_V	0.904	0.40
100_E	151_V	0.903	0.40
60_I	120_P	0.879	0.38
131_V	153_V	0.878	0.38
55_I	161_V	0.878	0.38
163_E	173_E	0.875	0.38
111_V	135_R	0.871	0.38
72_I	100_E	0.864	0.37
78_P	82_S	0.855	0.37
88_Q	91_C	0.851	0.36
37_K	41_P	0.845	0.36
155_M	162_I	0.840	0.36
120_P	127_Q	0.839	0.36
46_V	68_R	0.834	0.35
115_V	148_A	0.832	0.35
43_W	47_R	0.830	0.35
39_N	43_W	0.820	0.34
40_N	150_E	0.817	0.34
71_K	101_W	0.812	0.34
108_G	137_S	0.809	0.34
63_F	131_V	0.807	0.34
121_P	141_N	0.805	0.33
135_R	153_V	0.805	0.33
66_G	86_P	0.802	0.33
59_R	133_I	0.798	0.33
127_Q	130_I	0.797	0.33
35_E	110_I	0.789	0.32
169_Y	172_Y	0.782	0.32
37_K	40_N	0.778	0.32
92_P	134_A	0.767	0.31
35_E	40_N	0.767	0.31
85_F	141_N	0.763	0.31
72_I	141_N	0.756	0.31
51_L	118_V	0.753	0.30
110_I	144_G	0.748	0.30
75_T	80_C	0.732	0.29
131_V	162_I	0.721	0.29
40_N	44_I	0.721	0.29
39_N	96_I	0.720	0.28
91_C	131_V	0.720	0.28
69_E	147_R	0.717	0.28
60_I	70_G	0.714	0.28
35_E	38_T	0.712	0.28
41_P	69_E	0.708	0.28
41_P	45_D	0.706	0.28
65_E	124_S	0.700	0.27
75_T	112_A	0.699	0.27
59_R	114_T	0.693	0.27
116_V	144_G	0.691	0.27
54_Q	89_D	0.690	0.27
76_K	93_K	0.685	0.27
88_Q	92_P	0.684	0.27
59_R	75_T	0.682	0.26
76_K	100_E	0.680	0.26
61_F	95_K	0.676	0.26
101_W	143_L	0.676	0.26
79_K	134_A	0.674	0.26
132_G	146_V	0.668	0.26
67_L	108_G	0.664	0.25
83_I	102_I	0.664	0.25
63_F	73_L	0.661	0.25
102_I	154_G	0.653	0.25
54_Q	85_F	0.649	0.25
102_I	155_M	0.644	0.24
78_P	98_N	0.636	0.24
59_R	89_D	0.634	0.24
95_K	152_R	0.634	0.24
106_K	159_L	0.633	0.24
73_L	116_V	0.632	0.24
33_V	42_L	0.632	0.24
63_F	99_L	0.631	0.24
41_P	82_S	0.626	0.24
87_P	120_P	0.626	0.24
84_Y	114_T	0.622	0.23
68_R	155_M	0.620	0.23
73_L	129_Y	0.620	0.23
55_I	72_I	0.617	0.23
82_S	150_E	0.617	0.23
168_G	172_Y	0.615	0.23
162_I	173_E	0.614	0.23
118_V	147_R	0.610	0.23
103_E	120_P	0.610	0.23
88_Q	94_C	0.609	0.23
34_N	38_T	0.608	0.23
54_Q	106_K	0.607	0.23
35_E	46_V	0.607	0.23
59_R	117_N	0.604	0.22
63_F	140_V	0.604	0.22
119_K	131_V	0.601	0.22
110_I	130_I	0.598	0.22
86_P	151_V	0.598	0.22
45_D	65_E	0.591	0.22
137_S	146_V	0.591	0.22
111_V	146_V	0.587	0.22
74_A	85_F	0.585	0.22
122_S	129_Y	0.584	0.22
104_M	112_A	0.583	0.22
59_R	83_I	0.582	0.21
80_C	96_I	0.581	0.21
107_E	146_V	0.579	0.21
60_I	118_V	0.578	0.21
67_L	144_G	0.572	0.21
38_T	42_L	0.569	0.21
149_K	152_R	0.568	0.21
113_Y	130_I	0.566	0.21
86_P	102_I	0.562	0.21
67_L	172_Y	0.560	0.20
49_I	156_K	0.560	0.20
129_Y	145_W	0.560	0.20
35_E	42_L	0.559	0.20
80_C	101_W	0.558	0.20
106_K	117_N	0.556	0.20
40_N	82_S	0.553	0.20
113_Y	151_V	0.553	0.20
70_G	87_P	0.549	0.20
84_Y	117_N	0.543	0.20
88_Q	118_V	0.541	0.20
62_K	73_L	0.539	0.20
111_V	150_E	0.536	0.19
33_V	38_T	0.534	0.19
65_E	153_V	0.533	0.19
104_M	117_N	0.530	0.19
78_P	142_V	0.530	0.19
39_N	42_L	0.529	0.19
65_E	138_N	0.529	0.19
117_N	136_M	0.526	0.19
40_N	97_S	0.525	0.19
90_D	171_T	0.522	0.19
38_T	81_G	0.521	0.19
88_Q	95_K	0.521	0.19
131_V	148_A	0.520	0.19
104_M	138_N	0.518	0.19
116_V	120_P	0.518	0.19
80_C	141_N	0.518	0.19
117_N	139_G	0.516	0.19
88_Q	133_I	0.516	0.19
95_K	171_T	0.514	0.19
163_E	166_P	0.514	0.19
165_K	168_G	0.514	0.19
91_C	99_L	0.506	0.18
36_Q	166_P	0.504	0.18
97_S	149_K	0.502	0.18
100_E	146_V	0.501	0.18
53_Y	58_K	0.501	0.18
59_R	140_V	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3irbA	3	0.7584	100	0.442	Contact Map
2kdxA	1	0.5506	87.1	0.917	Contact Map
4d02A	2	0.1629	84.5	0.919	Contact Map
1lkoA	3	0.5843	84.3	0.92	Contact Map
5aunA	1	0.5506	83.5	0.921	Contact Map
3pwfA	4	0.4888	83.3	0.921	Contact Map
2lcqA	1	0.573	79.9	0.923	Contact Map
1yuzA	2	0.4888	78.7	0.924	Contact Map
1s24A	1	0.2022	71.7	0.929	Contact Map
4aybP	1	0.2135	64.4	0.932	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.