Q97UW0 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97UW0 - 4-carboxymucolactone decarboxylase (PcaC)

UniProt:	Q97UW0	Sequences: MGSLFDKDPELKKLYEKGLEVRKKVMGREYVEKSLSQTTDFNRELQEMVTIFAWGLIWTRDDVIPKKIRSLINIGILSCLNRQNELKLHVKGAIRNGCTEEEIKEVLLQVGAYCGLPAAMDSFRIAQEAIKELKEEEKG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	139 (122)
Sequences:	2526 (1577)
Seq/√Len:	142.8

BACSU - YURZ
SULSO - Q97UW0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
65_P	68_I	5.718	1.00
100_E	134_K	3.985	1.00
87_K	128_E	3.951	1.00
78_S	110_V	3.044	1.00
71_L	106_V	2.654	1.00
24_K	66_K	2.626	1.00
67_K	102_E	2.586	1.00
107_L	126_A	2.342	1.00
47_E	51_I	2.281	1.00
94_I	133_L	2.090	1.00
21_V	24_K	2.066	1.00
93_A	98_C	2.063	1.00
21_V	59_T	2.047	1.00
60_R	105_E	2.045	1.00
23_K	32_E	1.973	1.00
91_K	133_L	1.876	1.00
20_E	24_K	1.864	1.00
44_E	104_K	1.711	1.00
87_K	125_I	1.702	1.00
107_L	123_F	1.687	1.00
90_V	126_A	1.638	1.00
74_I	93_A	1.630	1.00
126_A	130_I	1.628	1.00
14_L	56_L	1.557	1.00
111_G	119_A	1.527	1.00
83_Q	121_D	1.483	1.00
74_I	86_L	1.460	1.00
44_E	47_E	1.404	1.00
45_L	123_F	1.369	1.00
95_R	133_L	1.292	1.00
23_K	28_R	1.288	1.00
35_L	38_T	1.284	1.00
70_S	96_N	1.284	1.00
32_E	36_S	1.268	1.00
82_R	118_A	1.259	1.00
21_V	66_K	1.257	1.00
53_A	112_A	1.227	1.00
28_R	32_E	1.208	1.00
17_K	20_E	1.207	1.00
17_K	59_T	1.206	1.00
99_T	102_E	1.198	1.00
76_I	79_C	1.166	1.00
90_V	103_I	1.140	0.99
100_E	130_I	1.138	0.99
129_A	133_L	1.131	0.99
44_E	108_L	1.117	0.99
85_E	121_D	1.110	0.99
51_I	56_L	1.098	0.99
13_K	17_K	1.096	0.99
74_I	103_I	1.096	0.99
78_S	107_L	1.087	0.99
52_F	56_L	1.084	0.99
75_G	106_V	1.035	0.99
112_A	116_L	1.031	0.99
12_K	16_E	1.018	0.99
15_Y	19_L	1.007	0.99
70_S	89_H	1.007	0.99
19_L	23_K	1.000	0.99
84_N	121_D	1.000	0.99
26_M	88_L	0.992	0.98
26_M	54_W	0.969	0.98
13_K	16_E	0.957	0.98
78_S	122_S	0.928	0.98
39_T	127_Q	0.916	0.97
72_I	75_G	0.907	0.97
103_I	126_A	0.902	0.97
79_C	114_C	0.898	0.97
16_E	19_L	0.896	0.97
94_I	130_I	0.889	0.97
46_Q	50_T	0.888	0.97
83_Q	125_I	0.885	0.97
68_I	71_L	0.884	0.97
112_A	119_A	0.879	0.97
68_I	102_E	0.878	0.97
15_Y	50_T	0.873	0.97
39_T	42_N	0.866	0.96
101_E	104_K	0.859	0.96
76_I	80_L	0.858	0.96
90_V	129_A	0.852	0.96
114_C	118_A	0.845	0.96
41_F	104_K	0.840	0.96
103_I	130_I	0.839	0.96
49_V	53_A	0.829	0.95
16_E	20_E	0.825	0.95
38_T	43_R	0.812	0.95
75_G	78_S	0.804	0.94
80_L	118_A	0.801	0.94
58_W	70_S	0.801	0.94
14_L	51_I	0.798	0.94
48_M	56_L	0.794	0.94
12_K	20_E	0.792	0.94
22_R	50_T	0.786	0.94
76_I	110_V	0.784	0.94
73_N	77_L	0.775	0.93
91_K	132_E	0.767	0.93
15_Y	47_E	0.754	0.92
77_L	86_L	0.746	0.92
36_S	39_T	0.743	0.92
45_L	49_V	0.736	0.91
64_I	72_I	0.736	0.91
52_F	116_L	0.733	0.91
69_R	73_N	0.731	0.91
91_K	129_A	0.716	0.90
49_V	116_L	0.712	0.90
104_K	123_F	0.710	0.90
40_D	43_R	0.699	0.89
74_I	107_L	0.693	0.89
60_R	108_L	0.690	0.89
107_L	119_A	0.690	0.89
74_I	98_C	0.688	0.88
107_L	122_S	0.686	0.88
109_Q	113_Y	0.677	0.88
68_I	98_C	0.672	0.87
26_M	30_Y	0.669	0.87
100_E	133_L	0.668	0.87
42_N	127_Q	0.665	0.87
104_K	126_A	0.663	0.87
67_K	98_C	0.661	0.86
33_K	36_S	0.657	0.86
25_V	66_K	0.654	0.86
72_I	76_I	0.651	0.86
15_Y	51_I	0.649	0.85
71_L	98_C	0.647	0.85
45_L	120_M	0.641	0.85
130_I	134_K	0.641	0.85
127_Q	131_K	0.636	0.84
52_F	57_I	0.633	0.84
116_L	120_M	0.633	0.84
128_E	132_E	0.633	0.84
52_F	112_A	0.631	0.84
53_A	116_L	0.626	0.83
93_A	103_I	0.625	0.83
45_L	119_A	0.619	0.83
93_A	96_N	0.617	0.82
79_C	110_V	0.617	0.82
42_N	104_K	0.614	0.82
52_F	109_Q	0.614	0.82
48_M	52_F	0.614	0.82
33_K	37_Q	0.612	0.82
43_R	47_E	0.612	0.82
73_N	109_Q	0.611	0.82
131_K	134_K	0.611	0.82
55_G	59_T	0.610	0.82
128_E	131_K	0.602	0.81
25_V	54_W	0.601	0.81
54_W	85_E	0.598	0.80
82_R	121_D	0.595	0.80
86_L	90_V	0.590	0.80
84_N	87_K	0.588	0.79
104_K	127_Q	0.586	0.79
130_I	133_L	0.584	0.79
42_N	108_L	0.569	0.77
121_D	124_R	0.567	0.77
75_G	114_C	0.567	0.77
27_G	31_V	0.566	0.77
75_G	79_C	0.564	0.76
91_K	95_R	0.561	0.76
19_L	35_L	0.560	0.76
74_I	90_V	0.559	0.76
19_L	28_R	0.555	0.75
111_G	116_L	0.553	0.75
15_Y	35_L	0.553	0.75
75_G	98_C	0.552	0.75
84_N	124_R	0.551	0.75
38_T	42_N	0.551	0.75
110_V	114_C	0.549	0.75
45_L	111_G	0.548	0.74
62_D	105_E	0.546	0.74
94_I	100_E	0.534	0.73
53_A	73_N	0.531	0.72
88_L	92_G	0.526	0.71
26_M	92_G	0.524	0.71
30_Y	34_S	0.521	0.71
34_S	38_T	0.519	0.70
69_R	126_A	0.518	0.70
89_H	117_P	0.515	0.70
48_M	112_A	0.513	0.70
70_S	109_Q	0.512	0.69
72_I	106_V	0.510	0.69
17_K	21_V	0.509	0.69
52_F	111_G	0.502	0.68
108_L	123_F	0.500	0.68
24_K	36_S	0.500	0.68

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4g9qA	3	0.8777	99.9	0.361	Contact Map
2af7A	6	0.8777	99.9	0.386	Contact Map
2q0tA	3	0.9424	99.9	0.456	Contact Map
1p8cA	6	0.8201	99.7	0.545	Contact Map
3d7iA	6	0.705	99.7	0.545	Contact Map
2qeuA	6	0.9137	99.7	0.555	Contact Map
3beyA	6	0.6763	99.7	0.567	Contact Map
1vkeA	6	0.8129	99.6	0.571	Contact Map
2cwqA	4	0.8561	99.5	0.61	Contact Map
2ouwA	6	0.9209	99.3	0.654	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.