Q97UU6 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97UU6 - Uncharacterized protein

UniProt:	Q97UU6	Sequences: MVKRNKVIKQQSCPLIDTINVISRKWLLLVLNTIGNEGKLGFNSILNSIDDISPKALSDVLKTMEEMGLVKKVIVKSSPPRVEYSLTYEGKKLRKAVIPLFKWAAEHTGHYECPILQSNKLNKEEYS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	127 (102)
Sequences:	9459 (5631)
Seq/√Len:	557.5

ECOLI - YTFH
BACSU - YYBR YTCD YDEP YKVN YODB HXLR YDZF YVAP
HALSA - Q9HPZ4 Q9HRG9
SULSO - Q97UU6 Q97U48

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
46_L	54_P	2.839	1.00
71_K	85_S	2.837	1.00
55_K	59_D	2.766	1.00
92_K	106_E	2.748	1.00
77_S	81_R	2.631	1.00
73_V	85_S	2.605	1.00
34_I	70_V	2.317	1.00
71_K	87_T	2.246	1.00
33_T	48_S	2.178	1.00
75_V	83_E	1.961	1.00
89_E	107_H	1.814	1.00
75_V	81_R	1.802	1.00
30_V	60_V	1.800	1.00
99_P	102_K	1.771	1.00
34_I	45_I	1.745	1.00
36_N	94_R	1.716	1.00
96_A	99_P	1.710	1.00
95_K	99_P	1.698	1.00
86_L	90_G	1.644	1.00
39_K	85_S	1.620	1.00
40_L	48_S	1.601	1.00
39_K	83_E	1.585	1.00
18_T	100_L	1.545	1.00
62_K	65_E	1.532	1.00
91_K	94_R	1.441	1.00
27_L	63_T	1.425	1.00
56_A	59_D	1.423	1.00
72_K	82_V	1.400	1.00
88_Y	91_K	1.381	1.00
69_L	90_G	1.300	1.00
54_P	58_S	1.285	1.00
27_L	60_V	1.253	1.00
101_F	105_A	1.237	1.00
92_K	103_W	1.236	1.00
24_R	63_T	1.222	1.00
18_T	104_A	1.218	1.00
21_V	67_M	1.194	1.00
43_N	47_N	1.194	1.00
89_E	92_K	1.185	1.00
17_D	108_T	1.148	1.00
34_I	40_L	1.146	1.00
74_I	82_V	1.129	1.00
40_L	44_S	1.129	1.00
73_V	83_E	1.126	1.00
31_L	86_L	1.118	1.00
75_V	79_P	1.116	1.00
41_G	83_E	1.109	1.00
24_R	60_V	1.105	1.00
89_E	110_H	1.100	1.00
69_L	93_L	1.092	1.00
74_I	79_P	1.076	1.00
42_F	58_S	1.071	1.00
21_V	69_L	1.061	1.00
92_K	107_H	1.052	1.00
65_E	70_V	1.032	1.00
24_R	27_L	1.030	1.00
76_K	79_P	1.028	1.00
58_S	62_K	1.023	1.00
28_L	97_V	1.002	1.00
75_V	80_P	0.985	1.00
30_V	49_I	0.964	1.00
74_I	80_P	0.960	1.00
27_L	64_M	0.958	1.00
85_S	91_K	0.955	1.00
52_I	57_L	0.955	1.00
75_V	78_S	0.946	1.00
94_R	98_I	0.918	1.00
95_K	102_K	0.912	1.00
93_L	103_W	0.894	1.00
14_P	105_A	0.886	1.00
44_S	47_N	0.879	1.00
43_N	46_L	0.859	1.00
56_A	60_V	0.858	1.00
32_N	101_F	0.845	1.00
32_N	36_N	0.842	1.00
42_F	54_P	0.841	1.00
53_S	56_A	0.824	1.00
68_G	89_E	0.817	1.00
37_E	40_L	0.813	1.00
96_A	100_L	0.805	1.00
27_L	67_M	0.804	1.00
33_T	45_I	0.797	1.00
102_K	106_E	0.787	1.00
40_L	45_I	0.787	1.00
74_I	78_S	0.773	1.00
16_I	20_N	0.772	1.00
49_I	52_I	0.757	1.00
63_T	67_M	0.746	1.00
26_W	52_I	0.737	1.00
30_V	52_I	0.736	1.00
17_D	107_H	0.736	1.00
98_I	102_K	0.720	1.00
11_Q	16_I	0.701	1.00
104_A	108_T	0.698	1.00
74_I	77_S	0.694	1.00
17_D	111_Y	0.686	1.00
19_I	100_L	0.681	1.00
107_H	110_H	0.663	1.00
59_D	63_T	0.663	1.00
33_T	37_E	0.662	1.00
78_S	82_V	0.654	1.00
52_I	82_V	0.653	1.00
98_I	101_F	0.647	1.00
41_G	75_V	0.639	1.00
36_N	98_I	0.638	1.00
77_S	83_E	0.624	1.00
65_E	72_K	0.614	1.00
29_L	49_I	0.614	1.00
105_A	108_T	0.611	1.00
11_Q	20_N	0.611	1.00
102_K	105_A	0.610	1.00
93_L	96_A	0.607	1.00
31_L	93_L	0.607	1.00
65_E	74_I	0.606	1.00
19_I	28_L	0.598	1.00
44_S	48_S	0.597	1.00
77_S	82_V	0.581	1.00
64_M	69_L	0.577	0.99
34_I	65_E	0.574	0.99
106_E	109_G	0.571	0.99
11_Q	17_D	0.571	0.99
29_L	33_T	0.570	0.99
34_I	39_K	0.566	0.99
77_S	80_P	0.564	0.99
9_K	15_L	0.560	0.99
36_N	86_L	0.560	0.99
89_E	111_Y	0.555	0.99
38_G	91_K	0.555	0.99
95_K	98_I	0.554	0.99
88_Y	92_K	0.554	0.99
15_L	108_T	0.545	0.99
103_W	107_H	0.545	0.99
89_E	108_T	0.543	0.99
73_V	76_K	0.542	0.99
96_A	104_A	0.541	0.99
54_P	60_V	0.539	0.99
79_P	82_V	0.537	0.99
86_L	91_K	0.530	0.99
15_L	32_N	0.526	0.99
10_Q	50_D	0.526	0.99
32_N	42_F	0.525	0.99
31_L	69_L	0.525	0.99
78_S	81_R	0.520	0.99
18_T	22_I	0.520	0.99
33_T	40_L	0.517	0.99
43_N	54_P	0.515	0.99
26_W	57_L	0.513	0.99
16_I	29_L	0.513	0.99
36_N	40_L	0.511	0.99
92_K	95_K	0.509	0.99
19_I	93_L	0.502	0.99
14_P	101_F	0.500	0.99
79_P	83_E	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4gcvA	3	0.8898	99.9	0.437	Contact Map
4a5nA	2	0.8268	99.7	0.512	Contact Map
1yyvA	2	0.8583	99.7	0.518	Contact Map
2hztA	2	0.748	99.7	0.524	Contact Map
1z7uA	2	0.874	99.7	0.538	Contact Map
2f2eA	4	0.937	99.7	0.543	Contact Map
2fswA	2	0.811	99.6	0.547	Contact Map
4hw0A	2	0.7717	99.6	0.569	Contact Map
3df8A	2	0.8031	99.5	0.586	Contact Map
4hqeA	2	0.8425	99.4	0.617	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.