Q97UT7 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97UT7 - Beta carotene hydroxylase (CrtZ)

UniProt:	Q97UT7	Sequences: MMLIYYVGMAVLTFVGMEFVARLMHKYVMHGLLWFIHEDHHKEKQAELEKNDLFGLVFASVSVYLFFLGIQGSYVALSIAIGMSSYGIAYFFIHDMVIHDRHLHLRSWGLKHRPFKDLILVHDIHHKEGKGNWGFLFVIKGLDKVPILKDE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	151 (137)
Sequences:	363 (187)
Seq/√Len:	16.0

SULSO - Q97UT7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
62_S	84_S	4.581	1.00
66_F	80_A	3.759	1.00
33_L	54_F	3.659	1.00
24_M	28_V	3.652	1.00
84_S	88_I	3.221	0.99
57_V	61_V	2.705	0.97
36_I	57_V	2.620	0.96
22_R	27_Y	2.611	0.96
14_F	89_A	2.471	0.94
38_E	42_K	2.237	0.91
13_T	79_I	2.225	0.90
10_A	85_S	2.179	0.89
6_Y	10_A	2.113	0.88
6_Y	78_S	2.028	0.86
96_M	104_H	1.984	0.84
63_V	67_F	1.966	0.84
22_R	26_K	1.901	0.82
79_I	91_F	1.808	0.78
38_E	50_K	1.773	0.77
77_L	81_I	1.730	0.75
12_L	16_G	1.658	0.72
8_G	16_G	1.586	0.68
59_A	63_V	1.566	0.67
19_F	23_L	1.561	0.67
63_V	81_I	1.532	0.65
80_A	105_L	1.529	0.65
10_A	78_S	1.515	0.64
8_G	12_L	1.501	0.64
132_N	139_I	1.496	0.63
64_Y	68_L	1.492	0.63
36_I	53_L	1.478	0.62
93_I	118_L	1.459	0.61
20_V	24_M	1.423	0.59
112_H	115_F	1.420	0.59
55_G	98_I	1.352	0.55
42_K	120_L	1.286	0.52
97_V	115_F	1.265	0.50
74_Y	78_S	1.265	0.50
97_V	120_L	1.242	0.49
39_D	105_L	1.240	0.49
75_V	79_I	1.239	0.49
13_T	26_K	1.237	0.49
39_D	50_K	1.230	0.48
18_E	25_H	1.227	0.48
35_F	54_F	1.215	0.48
38_E	48_L	1.202	0.47
16_G	19_F	1.192	0.46
96_M	103_L	1.185	0.46
117_D	143_D	1.173	0.45
117_D	138_V	1.173	0.45
13_T	62_S	1.125	0.42
119_I	132_N	1.123	0.42
53_L	135_F	1.120	0.42
103_L	141_G	1.097	0.41
98_I	117_D	1.092	0.40
96_M	118_L	1.092	0.40
33_L	110_L	1.088	0.40
48_L	135_F	1.069	0.39
58_F	86_Y	1.068	0.39
58_F	76_A	1.065	0.39
77_L	80_A	1.063	0.39
67_F	71_Q	1.033	0.37
131_G	141_G	1.032	0.37
23_L	28_V	1.025	0.37
39_D	123_D	1.015	0.36
88_I	92_F	1.011	0.36
39_D	84_S	1.002	0.36
138_V	143_D	0.981	0.34
19_F	28_V	0.962	0.33
55_G	135_F	0.960	0.33
39_D	115_F	0.952	0.33
20_V	23_L	0.927	0.32
28_V	32_L	0.927	0.32
98_I	143_D	0.925	0.32
76_A	137_F	0.925	0.32
33_L	36_I	0.924	0.32
97_V	119_I	0.915	0.31
17_M	25_H	0.913	0.31
74_Y	80_A	0.908	0.31
21_A	106_R	0.908	0.31
5_Y	64_Y	0.902	0.30
119_I	123_D	0.900	0.30
36_I	135_F	0.886	0.30
36_I	55_G	0.882	0.30
23_L	27_Y	0.881	0.29
10_A	81_I	0.866	0.29
46_A	97_V	0.866	0.29
61_V	83_M	0.860	0.28
98_I	142_L	0.856	0.28
15_V	23_L	0.854	0.28
43_E	104_H	0.853	0.28
42_K	140_K	0.849	0.28
24_M	79_I	0.844	0.28
22_R	83_M	0.832	0.27
81_I	84_S	0.825	0.27
105_L	123_D	0.821	0.27
58_F	91_F	0.819	0.27
55_G	117_D	0.808	0.26
5_Y	11_V	0.799	0.26
14_F	85_S	0.795	0.25
63_V	66_F	0.791	0.25
120_L	131_G	0.787	0.25
93_I	100_D	0.777	0.25
55_G	143_D	0.773	0.25
77_L	136_L	0.771	0.24
111_K	135_F	0.763	0.24
117_D	124_I	0.760	0.24
86_Y	91_F	0.755	0.24
50_K	80_A	0.754	0.24
48_L	102_H	0.749	0.24
89_A	93_I	0.745	0.23
6_Y	74_Y	0.741	0.23
118_L	137_F	0.738	0.23
97_V	117_D	0.737	0.23
57_V	76_A	0.733	0.23
28_V	48_L	0.732	0.23
97_V	132_N	0.731	0.23
31_G	86_Y	0.726	0.23
10_A	14_F	0.725	0.23
5_Y	88_I	0.720	0.22
119_I	140_K	0.718	0.22
110_L	131_G	0.717	0.22
35_F	61_V	0.715	0.22
9_M	124_I	0.713	0.22
20_V	58_F	0.701	0.22
56_L	110_L	0.701	0.22
24_M	81_I	0.698	0.21
6_Y	9_M	0.691	0.21
12_L	15_V	0.689	0.21
139_I	143_D	0.684	0.21
56_L	76_A	0.683	0.21
11_V	15_V	0.682	0.21
91_F	101_R	0.676	0.21
47_E	118_L	0.676	0.21
16_G	20_V	0.676	0.21
96_M	102_H	0.675	0.21
110_L	124_I	0.673	0.20
47_E	56_L	0.673	0.20
66_F	70_I	0.671	0.20
58_F	101_R	0.665	0.20
96_M	131_G	0.665	0.20
22_R	133_W	0.660	0.20
111_K	116_K	0.656	0.20
8_G	88_I	0.655	0.20
110_L	132_N	0.654	0.20
28_V	128_E	0.651	0.20
13_T	65_L	0.647	0.20
103_L	117_D	0.646	0.19
7_V	62_S	0.640	0.19
127_K	133_W	0.637	0.19
13_T	137_F	0.633	0.19
23_L	68_L	0.633	0.19
105_L	135_F	0.632	0.19
103_L	127_K	0.630	0.19
93_I	130_K	0.630	0.19
66_F	93_I	0.630	0.19
6_Y	75_V	0.624	0.19
11_V	38_E	0.617	0.18
9_M	75_V	0.615	0.18
123_D	136_L	0.607	0.18
29_M	58_F	0.603	0.18
124_I	131_G	0.600	0.18
60_S	89_A	0.592	0.18
29_M	132_N	0.589	0.18
69_G	78_S	0.586	0.17
28_V	44_K	0.581	0.17
92_F	105_L	0.581	0.17
21_A	55_G	0.580	0.17
26_K	133_W	0.579	0.17
13_T	123_D	0.577	0.17
7_V	48_L	0.574	0.17
14_F	138_V	0.568	0.17
92_F	141_G	0.567	0.17
36_I	130_K	0.567	0.17
15_V	112_H	0.565	0.17
123_D	135_F	0.561	0.17
56_L	81_I	0.560	0.17
39_D	127_K	0.556	0.16
60_S	63_V	0.554	0.16
89_A	98_I	0.552	0.16
50_K	70_I	0.552	0.16
8_G	11_V	0.550	0.16
68_L	83_M	0.548	0.16
93_I	112_H	0.546	0.16
33_L	116_K	0.543	0.16
12_L	59_A	0.537	0.16
110_L	113_R	0.529	0.16
124_I	141_G	0.529	0.16
102_H	130_K	0.526	0.16
100_D	123_D	0.524	0.15
123_D	130_K	0.522	0.15
100_D	132_N	0.522	0.15
16_G	73_S	0.522	0.15
13_T	81_I	0.521	0.15
8_G	48_L	0.518	0.15
11_V	88_I	0.515	0.15
8_G	128_E	0.515	0.15
16_G	85_S	0.511	0.15
97_V	111_K	0.510	0.15
140_K	143_D	0.505	0.15
92_F	96_M	0.504	0.15
21_A	24_M	0.503	0.15
7_V	83_M	0.502	0.15
31_G	118_L	0.501	0.15
120_L	132_N	0.500	0.15
26_K	93_I	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4zr0A	1	0.8808	99.1	0.808	Contact Map
4zr1A	1	0.8808	98.8	0.831	Contact Map
4ymkA	1	0.6623	7.1	0.963	Contact Map
1mhsA	2	0.4172	5.8	0.965	Contact Map
4qtnA	3	0.6159	4.6	0.967	Contact Map
3j1zP	8	0.9205	4.1	0.967	Contact Map
3h90A	3	0.9205	3.9	0.968	Contact Map
4mf5A	2	0.4702	2.7	0.97	Contact Map
2ls2A	1	0.1656	2.4	0.971	Contact Map
4krwA	2	0.1325	1.9	0.973	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.