Q97UQ9 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97UQ9 - First ORF in transposon ISC1904

UniProt:	Q97UQ9	Sequences: MLRPKEACQRLGISYATLREYVKKGYIKPVILQSGKWRFREEDIERLMGIIRKRKVILYARVSSNTQKDDLANQVKYLEEQVKEYDLVITDIGSGLNMKRKGFLKLLRMILNNEVSRVITAYPDRLVRFGFEILEEVCKAHNCEIVVLNQEDKTPEEELVEDLATILVSFSGKLHGMRSQKYEKVKKCAEELKN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	194 (185)
Sequences:	480 (334)
Seq/√Len:	24.5

SULSO - Q97UQ9 Q97XI0 Q97XQ1 Q97U52 Q97U67 Q97YH2 Q97XB5 Q97YX0 Q97YU0 Q97YI6 Q97XZ4 Q97X40 Q97Z60 Q97X25 Q97WZ6 Q97Y49

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
56_V	117_R	4.312	1.00
60_A	78_L	4.247	1.00
117_R	144_E	3.606	1.00
82_V	119_I	3.584	1.00
103_F	126_L	2.756	0.99
7_A	11_L	2.752	0.99
110_I	138_C	2.679	0.99
58_L	148_L	2.580	0.99
17_T	21_Y	2.512	0.99
13_I	21_Y	2.491	0.99
135_E	139_K	2.411	0.98
91_D	102_G	2.405	0.98
5_K	9_Q	2.379	0.98
106_L	115_V	2.324	0.98
16_A	19_R	2.244	0.97
111_L	141_H	2.220	0.97
58_L	78_L	2.145	0.96
18_L	39_F	2.127	0.96
75_V	88_V	2.121	0.96
85_Y	146_V	2.044	0.95
22_V	37_W	2.023	0.95
98_M	132_E	1.933	0.94
3_R	34_S	1.870	0.92
119_I	132_E	1.859	0.92
96_L	129_F	1.820	0.91
77_Y	121_A	1.735	0.89
75_V	90_T	1.730	0.89
55_K	109_M	1.713	0.89
131_F	145_I	1.688	0.88
110_I	118_V	1.683	0.88
127_V	131_F	1.678	0.87
89_I	102_G	1.657	0.87
110_I	115_V	1.631	0.86
58_L	88_V	1.623	0.86
110_I	120_T	1.612	0.85
138_C	143_C	1.567	0.84
22_V	29_P	1.566	0.84
40_R	43_D	1.551	0.83
26_Y	33_Q	1.506	0.81
16_A	24_K	1.501	0.81
98_M	169_S	1.472	0.79
4_P	19_R	1.452	0.78
12_G	142_N	1.422	0.77
168_V	179_S	1.413	0.77
138_C	174_L	1.382	0.75
157_E	161_E	1.367	0.74
96_L	130_G	1.364	0.74
109_M	114_E	1.361	0.74
17_T	20_E	1.352	0.73
31_I	37_W	1.350	0.73
27_I	30_V	1.340	0.73
72_A	76_K	1.325	0.72
7_A	44_I	1.308	0.71
169_S	172_G	1.304	0.70
119_I	146_V	1.256	0.68
76_K	79_E	1.252	0.67
56_V	144_E	1.249	0.67
7_A	27_I	1.244	0.67
4_P	18_L	1.218	0.65
70_D	73_N	1.216	0.65
121_A	180_Q	1.214	0.65
57_I	75_V	1.207	0.64
122_Y	161_E	1.204	0.64
107_L	111_L	1.201	0.64
175_H	178_R	1.199	0.64
8_C	13_I	1.180	0.63
62_V	67_Q	1.179	0.62
14_S	20_E	1.177	0.62
15_Y	19_R	1.176	0.62
168_V	172_G	1.173	0.62
131_F	147_V	1.171	0.62
22_V	39_F	1.171	0.62
8_C	15_Y	1.150	0.61
172_G	177_M	1.143	0.60
166_I	176_G	1.139	0.60
122_Y	153_K	1.135	0.59
20_E	23_K	1.126	0.59
75_V	107_L	1.110	0.58
89_I	118_V	1.109	0.58
22_V	27_I	1.108	0.58
78_L	148_L	1.107	0.58
91_D	169_S	1.101	0.57
56_V	119_I	1.085	0.56
67_Q	70_D	1.078	0.55
95_G	126_L	1.067	0.55
3_R	38_R	1.063	0.54
89_I	106_L	1.058	0.54
57_I	89_I	1.045	0.53
62_V	71_L	1.038	0.53
58_L	82_V	1.030	0.52
117_R	146_V	1.025	0.52
28_K	43_D	1.018	0.51
27_I	134_L	1.009	0.51
43_D	46_R	1.008	0.50
161_E	172_G	0.999	0.50
8_C	18_L	0.992	0.49
127_V	134_L	0.987	0.49
82_V	85_Y	0.984	0.49
39_F	43_D	0.975	0.48
14_S	174_L	0.971	0.48
56_V	93_G	0.956	0.47
110_I	143_C	0.944	0.46
91_D	121_A	0.944	0.46
5_K	34_S	0.940	0.46
131_F	134_L	0.939	0.46
19_R	39_F	0.929	0.45
72_A	75_V	0.929	0.45
138_C	171_S	0.922	0.44
54_R	142_N	0.917	0.44
4_P	15_Y	0.917	0.44
158_E	170_F	0.909	0.43
81_Q	146_V	0.906	0.43
64_S	67_Q	0.904	0.43
13_I	20_E	0.900	0.43
73_N	164_A	0.886	0.42
129_F	162_D	0.886	0.42
153_K	173_K	0.885	0.42
7_A	18_L	0.872	0.41
95_G	103_F	0.860	0.40
7_A	38_R	0.853	0.39
4_P	29_P	0.852	0.39
118_V	145_I	0.843	0.39
98_M	127_V	0.843	0.39
19_R	22_V	0.840	0.39
163_L	167_L	0.839	0.39
79_E	88_V	0.836	0.38
26_Y	34_S	0.833	0.38
148_L	156_E	0.823	0.37
11_L	18_L	0.816	0.37
172_G	179_S	0.815	0.37
70_D	121_A	0.814	0.37
22_V	31_I	0.811	0.37
63_S	67_Q	0.810	0.37
42_E	73_N	0.805	0.36
4_P	7_A	0.804	0.36
119_I	134_L	0.802	0.36
67_Q	73_N	0.801	0.36
91_D	185_V	0.801	0.36
72_A	186_K	0.797	0.36
107_L	146_V	0.796	0.36
77_Y	149_N	0.792	0.35
64_S	73_N	0.791	0.35
159_L	168_V	0.783	0.35
18_L	22_V	0.775	0.34
19_R	31_I	0.773	0.34
78_L	151_E	0.771	0.34
160_V	163_L	0.768	0.34
108_R	140_A	0.765	0.34
81_Q	149_N	0.763	0.34
44_I	118_V	0.762	0.33
8_C	173_K	0.751	0.33
9_Q	68_K	0.751	0.33
3_R	33_Q	0.750	0.33
157_E	160_V	0.746	0.32
168_V	180_Q	0.744	0.32
134_L	138_C	0.741	0.32
121_A	168_V	0.737	0.32
34_S	113_N	0.733	0.32
48_M	51_I	0.732	0.32
84_E	119_I	0.730	0.31
76_K	80_E	0.730	0.31
81_Q	85_Y	0.727	0.31
173_K	177_M	0.726	0.31
163_L	176_G	0.726	0.31
27_I	43_D	0.718	0.31
120_T	145_I	0.717	0.31
78_L	143_C	0.716	0.31
23_K	31_I	0.714	0.30
153_K	161_E	0.709	0.30
93_G	165_T	0.702	0.30
57_I	115_V	0.701	0.30
100_R	127_V	0.700	0.30
111_L	137_V	0.698	0.29
6_E	43_D	0.695	0.29
97_N	141_H	0.694	0.29
99_K	173_K	0.693	0.29
51_I	116_S	0.690	0.29
19_R	36_K	0.687	0.29
57_I	106_L	0.683	0.29
73_N	76_K	0.676	0.28
68_K	181_K	0.671	0.28
6_E	146_V	0.668	0.28
54_R	143_C	0.666	0.28
147_V	167_L	0.663	0.27
19_R	37_W	0.662	0.27
120_T	162_D	0.657	0.27
13_I	38_R	0.654	0.27
183_E	186_K	0.651	0.27
87_L	100_R	0.650	0.27
162_D	176_G	0.650	0.27
63_S	128_R	0.644	0.26
180_Q	186_K	0.640	0.26
30_V	38_R	0.639	0.26
93_G	154_T	0.637	0.26
184_K	187_K	0.636	0.26
159_L	162_D	0.633	0.26
3_R	36_K	0.633	0.26
119_I	136_E	0.625	0.25
30_V	43_D	0.621	0.25
14_S	22_V	0.619	0.25
8_C	103_F	0.619	0.25
4_P	8_C	0.613	0.25
6_E	159_L	0.612	0.25
103_F	116_S	0.604	0.24
13_I	16_A	0.603	0.24
119_I	183_E	0.603	0.24
103_F	169_S	0.602	0.24
33_Q	113_N	0.601	0.24
129_F	166_I	0.599	0.24
130_G	171_S	0.597	0.24
15_Y	37_W	0.597	0.24
155_P	177_M	0.596	0.24
146_V	152_D	0.593	0.24
134_L	155_P	0.585	0.23
163_L	166_I	0.584	0.23
77_Y	165_T	0.578	0.23
171_S	177_M	0.577	0.23
123_P	167_L	0.576	0.23
35_G	106_L	0.573	0.23
57_I	150_Q	0.567	0.22
97_N	128_R	0.566	0.22
103_F	127_V	0.565	0.22
93_G	144_E	0.564	0.22
152_D	167_L	0.564	0.22
26_Y	167_L	0.563	0.22
120_T	147_V	0.561	0.22
66_T	121_A	0.559	0.22
13_I	31_I	0.559	0.22
129_F	176_G	0.557	0.22
101_K	156_E	0.556	0.22
96_L	133_I	0.555	0.22
22_V	32_L	0.554	0.22
128_R	175_H	0.553	0.22
159_L	170_F	0.553	0.22
23_K	101_K	0.553	0.22
145_I	148_L	0.547	0.21
56_V	116_S	0.546	0.21
54_R	112_N	0.543	0.21
44_I	48_M	0.541	0.21
12_G	129_F	0.541	0.21
55_K	116_S	0.540	0.21
85_Y	96_L	0.539	0.21
16_A	36_K	0.538	0.21
162_D	166_I	0.538	0.21
5_K	8_C	0.538	0.21
137_V	140_A	0.537	0.21
55_K	91_D	0.537	0.21
77_Y	180_Q	0.535	0.21
167_L	171_S	0.533	0.21
16_A	20_E	0.533	0.21
20_E	29_P	0.533	0.21
127_V	165_T	0.532	0.21
6_E	10_R	0.532	0.21
29_P	43_D	0.532	0.21
123_P	181_K	0.531	0.21
106_L	138_C	0.530	0.21
149_N	152_D	0.525	0.20
58_L	149_N	0.523	0.20
177_M	184_K	0.522	0.20
118_V	147_V	0.520	0.20
9_Q	76_K	0.519	0.20
118_V	126_L	0.517	0.20
180_Q	184_K	0.516	0.20
126_L	133_I	0.515	0.20
86_D	119_I	0.514	0.20
8_C	12_G	0.513	0.20
13_I	18_L	0.512	0.20
112_N	152_D	0.512	0.20
154_T	180_Q	0.511	0.20
115_V	143_C	0.509	0.20
100_R	155_P	0.507	0.19
30_V	36_K	0.507	0.19
63_S	129_F	0.505	0.19
97_N	106_L	0.505	0.19
92_I	100_R	0.504	0.19
118_V	152_D	0.503	0.19
9_Q	51_I	0.501	0.19
110_I	145_I	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ilxA	2	0.7216	100	0.64	Contact Map
3lhkA	2	0.732	100	0.648	Contact Map
3g13A	2	0.7165	99.8	0.735	Contact Map
3bvpA	4	0.6289	99.8	0.74	Contact Map
3guvA	2	0.6959	99.8	0.743	Contact Map
4bqqA	2	0.7113	99.8	0.749	Contact Map
2mhcA	1	0.5567	99.8	0.75	Contact Map
2gm5A	4	0.6186	99.8	0.755	Contact Map
3pkzA	4	0.5722	99.7	0.76	Contact Map
1gdtA	2	0.6856	99.7	0.762	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.