Q97UQ2 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97UQ2 - Deoxycytidine triphosphate deaminase (DcD-2)

UniProt:	Q97UQ2	Sequences: MSNLFSEMILSHQSIKKLLGKVIINYVEENVRENGYDLRICGDKYYVVEEGAQLPAIKAKIREIPFKEVADLSPLKTYLFESCEEFNMPENLAVLITLKSTMARNGFLAPPTVIDAGYKGKIYLAITSVYNSSLAKGISTHHLIFLELDQRTERIYSGKYQGGIPI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	166 (156)
Sequences:	1948 (914)
Seq/√Len:	73.2

ECOLI - DCD
HALSA - DCD DUT
SULSO - Q97UQ2 DCD

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
87_N	119_K	5.305	1.00
39_R	83_C	3.744	1.00
17_K	21_K	3.600	1.00
114_I	122_I	3.337	1.00
38_L	141_H	3.308	1.00
91_N	147_E	2.907	1.00
83_C	137_G	2.476	1.00
23_I	36_Y	2.335	1.00
107_F	132_S	2.289	1.00
94_V	145_F	2.250	1.00
100_S	104_R	2.197	1.00
16_K	153_E	2.194	1.00
14_S	149_D	2.080	1.00
81_E	121_K	2.031	1.00
30_N	39_R	2.004	1.00
34_N	116_A	1.903	1.00
85_E	119_K	1.901	1.00
95_L	146_L	1.884	1.00
26_Y	36_Y	1.819	1.00
11_S	14_S	1.770	1.00
41_C	81_E	1.769	1.00
16_K	28_E	1.769	1.00
56_A	59_A	1.748	1.00
14_S	150_Q	1.725	1.00
38_L	143_L	1.713	1.00
14_S	17_K	1.672	1.00
119_K	162_G	1.631	1.00
118_Y	163_G	1.600	0.99
18_L	92_L	1.594	0.99
73_S	76_K	1.574	0.99
88_M	94_V	1.553	0.99
88_M	92_L	1.516	0.99
31_V	36_Y	1.512	0.99
19_L	26_Y	1.490	0.99
26_Y	31_V	1.471	0.99
114_I	143_L	1.455	0.99
59_A	62_R	1.450	0.99
100_S	142_H	1.420	0.99
10_L	14_S	1.409	0.99
9_I	146_L	1.362	0.98
43_D	63_E	1.357	0.98
104_R	142_H	1.352	0.98
41_C	137_G	1.348	0.98
13_Q	153_E	1.331	0.98
90_E	155_I	1.316	0.98
69_V	133_S	1.305	0.98
83_C	136_K	1.253	0.97
99_K	139_S	1.247	0.97
48_V	62_R	1.232	0.97
125_A	163_G	1.207	0.96
14_S	18_L	1.194	0.96
38_L	86_F	1.192	0.96
15_I	36_Y	1.172	0.95
18_L	89_P	1.171	0.95
32_R	142_H	1.167	0.95
152_T	155_I	1.166	0.95
102_M	138_I	1.158	0.95
73_S	131_N	1.156	0.95
98_L	103_A	1.152	0.95
18_L	91_N	1.151	0.95
115_D	118_Y	1.151	0.95
57_I	62_R	1.134	0.94
47_V	79_L	1.120	0.94
98_L	110_P	1.119	0.94
71_D	133_S	1.101	0.94
109_A	141_H	1.094	0.93
30_N	139_S	1.092	0.93
115_D	160_Y	1.090	0.93
69_V	135_A	1.090	0.93
82_S	124_L	1.076	0.93
27_V	30_N	1.069	0.93
112_T	115_D	1.069	0.93
95_L	113_V	1.050	0.92
108_L	127_T	1.048	0.92
11_S	150_Q	1.044	0.92
80_F	98_L	1.033	0.91
91_N	151_R	1.024	0.91
148_L	152_T	1.020	0.91
57_I	60_K	1.012	0.90
94_V	114_I	0.998	0.90
37_D	99_K	0.998	0.90
31_V	34_N	0.991	0.89
38_L	82_S	0.979	0.89
9_I	93_A	0.975	0.89
65_P	69_V	0.968	0.88
40_I	80_F	0.968	0.88
99_K	142_H	0.966	0.88
46_Y	106_G	0.961	0.88
10_L	147_E	0.958	0.88
46_Y	50_E	0.958	0.88
9_I	144_I	0.942	0.87
101_T	142_H	0.940	0.87
56_A	60_K	0.938	0.87
89_P	92_L	0.932	0.86
48_V	60_K	0.912	0.85
94_V	143_L	0.910	0.85
55_P	59_A	0.907	0.85
103_A	125_A	0.902	0.84
66_F	69_V	0.898	0.84
126_I	134_L	0.898	0.84
80_F	126_I	0.873	0.82
55_P	60_K	0.873	0.82
97_T	110_P	0.868	0.82
58_K	61_I	0.867	0.82
144_I	148_L	0.863	0.82
89_P	120_G	0.862	0.82
79_L	123_Y	0.859	0.81
16_K	20_G	0.854	0.81
27_V	39_R	0.852	0.81
32_R	37_D	0.849	0.81
103_A	112_T	0.847	0.81
74_P	107_F	0.843	0.80
99_K	104_R	0.839	0.80
90_E	117_G	0.838	0.80
74_P	131_N	0.829	0.79
72_L	126_I	0.828	0.79
35_G	144_I	0.812	0.78
22_V	87_N	0.811	0.78
56_A	62_R	0.806	0.77
115_D	120_G	0.787	0.75
40_I	134_L	0.786	0.75
33_E	142_H	0.777	0.74
37_D	144_I	0.777	0.74
98_L	163_G	0.776	0.74
95_L	144_I	0.765	0.73
21_K	63_E	0.763	0.73
76_K	139_S	0.761	0.73
20_G	26_Y	0.761	0.73
24_I	27_V	0.750	0.72
68_E	71_D	0.746	0.71
16_K	31_V	0.746	0.71
58_K	64_I	0.742	0.71
90_E	151_R	0.740	0.71
113_V	118_Y	0.726	0.69
107_F	126_I	0.718	0.69
44_K	70_A	0.717	0.68
16_K	21_K	0.715	0.68
17_K	22_V	0.712	0.68
55_P	64_I	0.707	0.67
79_L	98_L	0.705	0.67
60_K	64_I	0.701	0.67
35_G	158_G	0.700	0.67
17_K	20_G	0.691	0.66
35_G	113_V	0.687	0.65
56_A	64_I	0.681	0.64
118_Y	122_I	0.678	0.64
48_V	51_G	0.675	0.64
12_H	154_R	0.674	0.64
97_T	118_Y	0.673	0.64
24_I	85_E	0.667	0.63
82_S	98_L	0.656	0.62
12_H	15_I	0.654	0.61
15_I	23_I	0.648	0.61
107_F	128_S	0.647	0.60
79_L	124_L	0.642	0.60
77_T	127_T	0.642	0.60
106_G	141_H	0.638	0.59
80_F	140_T	0.638	0.59
15_I	26_Y	0.635	0.59
128_S	132_S	0.633	0.59
72_L	141_H	0.631	0.59
93_A	113_V	0.630	0.58
43_D	81_E	0.629	0.58
133_S	136_K	0.628	0.58
86_F	143_L	0.628	0.58
82_S	103_A	0.619	0.57
19_L	36_Y	0.619	0.57
29_E	59_A	0.610	0.56
20_G	28_E	0.610	0.56
103_A	110_P	0.610	0.56
106_G	128_S	0.608	0.56
32_R	100_S	0.606	0.56
24_I	87_N	0.603	0.55
100_S	103_A	0.600	0.55
50_E	53_Q	0.597	0.54
55_P	61_I	0.595	0.54
82_S	123_Y	0.593	0.54
15_I	33_E	0.592	0.54
94_V	118_Y	0.588	0.53
71_D	76_K	0.587	0.53
97_T	103_A	0.586	0.53
34_N	135_A	0.586	0.53
67_K	154_R	0.582	0.53
85_E	121_K	0.580	0.52
70_A	96_I	0.579	0.52
124_L	140_T	0.574	0.52
126_I	140_T	0.571	0.51
96_I	114_I	0.570	0.51
82_S	140_T	0.569	0.51
62_R	65_P	0.569	0.51
70_A	73_S	0.568	0.51
58_K	62_R	0.563	0.50
27_V	124_L	0.562	0.50
24_I	28_E	0.561	0.50
107_F	113_V	0.556	0.49
47_V	50_E	0.549	0.48
134_L	148_L	0.549	0.48
95_L	111_P	0.548	0.48
26_Y	30_N	0.547	0.48
75_L	129_V	0.547	0.48
13_Q	17_K	0.546	0.48
99_K	159_K	0.546	0.48
31_V	157_S	0.543	0.48
104_R	120_G	0.543	0.48
55_P	58_K	0.540	0.47
150_Q	153_E	0.539	0.47
15_I	145_F	0.536	0.47
95_L	112_T	0.534	0.47
38_L	94_V	0.531	0.46
90_E	145_F	0.529	0.46
93_A	115_D	0.529	0.46
46_Y	76_K	0.529	0.46
91_N	119_K	0.527	0.46
14_S	152_T	0.526	0.46
89_P	145_F	0.524	0.45
90_E	154_R	0.524	0.45
79_L	125_A	0.523	0.45
59_A	68_E	0.521	0.45
38_L	140_T	0.521	0.45
81_E	122_I	0.519	0.45
42_G	147_E	0.518	0.45
40_I	140_T	0.518	0.45
25_N	84_E	0.517	0.45
73_S	78_Y	0.515	0.44
45_Y	81_E	0.513	0.44
49_E	130_Y	0.512	0.44
13_Q	150_Q	0.512	0.44
46_Y	49_E	0.511	0.44
78_Y	122_I	0.507	0.43
11_S	148_L	0.504	0.43
68_E	136_K	0.502	0.43
57_I	64_I	0.501	0.43
82_S	99_K	0.501	0.43
93_A	144_I	0.500	0.42

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2yzjA	3	0.9518	100	0.203	Contact Map
1xs1A	5	0.9578	100	0.25	Contact Map
4xjcA	3	0.9458	100	0.253	Contact Map
2qxxA	3	0.9578	100	0.26	Contact Map
1pkhA	5	0.8916	100	0.262	Contact Map
4dhkA	5	0.8855	100	0.263	Contact Map
3km3A	4	0.8675	100	0.272	Contact Map
2r9qA	4	0.9337	100	0.348	Contact Map
3lqwA	3	0.7048	99.9	0.566	Contact Map
1dunA	3	0.7108	99.9	0.581	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.