Q97UN4 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97UN4 - Quinol oxidase-2, subunit II (SoxH)

UniProt:	Q97UN4	Sequences: MEKARIFELSTIVFAIVILTVLGVFSDIYLNSINTGAYLSTTQRQDAIPIKVVAMQYAWEFIYPNGTTTTDQLVLKANQTYLLEITSKDVIHAFYIPQLGFKFEAIPGYVYDFYIVVNKPGVYDIWCAEFCGPGHYLMKGTLVVVS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	146 (135)
Sequences:	5650 (2595)
Seq/√Len:	223.3

ECOLI - CYOA
BACSU - COX2 QOX2
HALSA - Q9HRJ9 Q9HN94
SULSO - Q97UN4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
85_I	105_A	3.627	1.00
55_M	60_E	2.946	1.00
50_I	73_L	2.869	1.00
77_A	120_P	2.603	1.00
117_V	144_V	2.563	1.00
77_A	144_V	2.558	1.00
75_L	117_V	2.417	1.00
83_L	115_I	2.375	1.00
51_K	62_I	2.333	1.00
72_Q	143_V	2.224	1.00
53_V	86_T	2.159	1.00
47_A	79_Q	2.019	1.00
55_M	88_K	2.009	1.00
127_C	131_C	1.986	1.00
49_P	82_L	1.975	1.00
102_K	129_E	1.956	1.00
95_Y	128_A	1.911	1.00
53_V	62_I	1.793	1.00
80_T	116_V	1.789	1.00
122_V	141_T	1.777	1.00
125_I	140_G	1.766	1.00
74_V	143_V	1.746	1.00
54_A	105_A	1.729	1.00
85_I	103_F	1.708	1.00
55_M	58_A	1.702	1.00
81_Y	117_V	1.681	1.00
122_V	143_V	1.657	1.00
51_K	84_E	1.652	1.00
93_A	128_A	1.625	1.00
82_L	112_D	1.617	1.00
75_L	142_L	1.599	1.00
52_V	83_L	1.515	1.00
28_I	32_S	1.495	1.00
120_P	144_V	1.480	1.00
131_C	135_H	1.476	1.00
99_L	117_V	1.459	1.00
103_F	113_F	1.437	1.00
93_A	129_E	1.434	1.00
76_K	81_Y	1.429	1.00
49_P	84_E	1.415	1.00
104_E	129_E	1.404	1.00
93_A	102_K	1.399	1.00
84_E	110_V	1.397	1.00
92_H	131_C	1.387	1.00
92_H	127_C	1.378	1.00
6_I	10_S	1.378	1.00
24_V	28_I	1.329	1.00
61_F	140_G	1.322	1.00
99_L	142_L	1.298	1.00
72_Q	141_T	1.290	1.00
127_C	135_H	1.280	1.00
47_A	80_T	1.263	1.00
50_I	83_L	1.242	1.00
51_K	86_T	1.237	1.00
61_F	73_L	1.228	1.00
67_T	70_T	1.185	1.00
100_G	115_I	1.107	1.00
96_I	142_L	1.081	1.00
102_K	128_A	1.079	1.00
13_V	17_V	1.075	1.00
135_H	138_M	1.055	1.00
5_R	9_L	1.055	1.00
126_W	139_K	1.054	1.00
72_Q	122_V	1.035	1.00
124_D	141_T	1.031	1.00
124_D	139_K	1.011	1.00
127_C	138_M	1.008	1.00
131_C	138_M	0.995	1.00
103_F	111_Y	0.989	1.00
134_G	137_L	0.975	1.00
44_R	47_A	0.974	1.00
52_V	61_F	0.956	1.00
117_V	120_P	0.926	1.00
61_F	94_F	0.926	1.00
83_L	113_F	0.924	1.00
50_I	63_Y	0.921	0.99
56_Q	89_D	0.919	0.99
84_E	112_D	0.916	0.99
52_V	85_I	0.916	0.99
34_N	103_F	0.902	0.99
31_N	34_N	0.898	0.99
75_L	115_I	0.895	0.99
30_L	34_N	0.886	0.99
44_R	114_Y	0.879	0.99
50_I	75_L	0.876	0.99
36_G	114_Y	0.871	0.99
49_P	65_N	0.862	0.99
27_D	31_N	0.862	0.99
18_I	21_V	0.861	0.99
89_D	92_H	0.857	0.99
44_R	80_T	0.851	0.99
96_I	99_L	0.851	0.99
19_L	25_F	0.832	0.99
48_I	81_Y	0.827	0.99
75_L	81_Y	0.827	0.99
17_V	21_V	0.826	0.99
101_F	113_F	0.821	0.99
123_Y	144_V	0.818	0.99
19_L	23_G	0.805	0.99
24_V	32_S	0.802	0.99
61_F	125_I	0.798	0.99
94_F	142_L	0.794	0.99
66_G	69_T	0.781	0.98
36_G	112_D	0.780	0.98
48_I	76_K	0.772	0.98
86_T	110_V	0.772	0.98
56_Q	90_V	0.765	0.98
91_I	106_I	0.764	0.98
106_I	109_Y	0.761	0.98
66_G	70_T	0.756	0.98
78_N	118_N	0.755	0.98
57_Y	90_V	0.733	0.97
73_L	83_L	0.732	0.97
78_N	116_V	0.732	0.97
9_L	13_V	0.732	0.97
23_G	26_S	0.727	0.97
48_I	79_Q	0.721	0.97
95_Y	101_F	0.720	0.97
11_T	15_A	0.718	0.97
82_L	114_Y	0.703	0.97
120_P	123_Y	0.694	0.97
80_T	114_Y	0.688	0.96
92_H	135_H	0.686	0.96
83_L	94_F	0.678	0.96
58_A	134_G	0.674	0.96
15_A	25_F	0.671	0.96
85_I	113_F	0.667	0.96
7_F	11_T	0.660	0.95
90_V	129_E	0.660	0.95
77_A	119_K	0.653	0.95
95_Y	126_W	0.650	0.95
104_E	128_A	0.645	0.95
87_S	91_I	0.642	0.95
56_Q	130_F	0.639	0.95
20_T	24_V	0.638	0.94
26_S	30_L	0.636	0.94
100_G	125_I	0.634	0.94
29_Y	32_S	0.630	0.94
16_I	19_L	0.625	0.94
15_A	26_S	0.623	0.94
46_D	79_Q	0.623	0.94
77_A	117_V	0.622	0.94
99_L	144_V	0.621	0.94
7_F	10_S	0.618	0.93
6_I	9_L	0.610	0.93
30_L	33_I	0.610	0.93
29_Y	33_I	0.610	0.93
53_V	60_E	0.603	0.93
10_S	15_A	0.593	0.92
52_V	94_F	0.592	0.92
93_A	104_E	0.590	0.92
75_L	144_V	0.587	0.92
112_D	119_K	0.587	0.92
125_I	142_L	0.586	0.92
15_A	23_G	0.579	0.91
81_Y	115_I	0.578	0.91
14_F	17_V	0.577	0.91
23_G	27_D	0.568	0.90
66_G	80_T	0.568	0.90
77_A	118_N	0.567	0.90
73_L	142_L	0.566	0.90
59_W	105_A	0.566	0.90
24_V	29_Y	0.566	0.90
95_Y	102_K	0.565	0.90
51_K	64_P	0.565	0.90
46_D	49_P	0.565	0.90
54_A	92_H	0.564	0.90
117_V	142_L	0.564	0.90
47_A	116_V	0.562	0.90
45_Q	78_N	0.557	0.89
57_Y	133_P	0.555	0.89
62_I	68_T	0.554	0.89
54_A	87_S	0.553	0.89
10_S	14_F	0.553	0.89
28_I	31_N	0.549	0.89
98_Q	119_K	0.549	0.89
96_I	123_Y	0.548	0.89
96_I	121_G	0.548	0.89
63_Y	76_K	0.547	0.89
95_Y	136_Y	0.546	0.88
46_D	82_L	0.546	0.88
14_F	114_Y	0.544	0.88
71_D	74_V	0.543	0.88
45_Q	79_Q	0.542	0.88
60_E	88_K	0.541	0.88
90_V	131_C	0.536	0.88
26_S	31_N	0.534	0.87
89_D	127_C	0.534	0.87
91_I	107_P	0.529	0.87
21_V	27_D	0.525	0.87
4_A	16_I	0.522	0.86
87_S	105_A	0.521	0.86
57_Y	130_F	0.516	0.86
94_F	101_F	0.514	0.85
130_F	133_P	0.512	0.85
53_V	88_K	0.512	0.85
8_E	12_I	0.509	0.85
26_S	29_Y	0.504	0.84
80_T	118_N	0.504	0.84
63_Y	73_L	0.503	0.84
101_F	115_I	0.502	0.84
5_R	80_T	0.500	0.84

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3hb3B	1	0.9589	100	0.084	Contact Map
1v54B	1	0.9521	100	0.085	Contact Map
1fftB	1	0.9863	100	0.091	Contact Map
2gsmB	1	0.9521	100	0.095	Contact Map
2yevB	1	0.9521	100	0.138	Contact Map
4txvB	1	0.7466	100	0.244	Contact Map
1cyxA	1	0.6918	100	0.265	Contact Map
3s8fB	1	0.9521	100	0.308	Contact Map
2cuaA	1	0.8082	100	0.496	Contact Map
3sbqA	2	0.9658	99.9	0.536	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.