Q97UN2 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97UN2 - Quinol oxidase-2, rieske iron-sulfur protein-2 (SoxF)

UniProt:	Q97UN2	Sequences: MMNRRTFLRLYLVVGAAVAIAPLIKPLADYVGYFYNEIGTMSKQYLVANNTDGLSGFPKYRIANIKDIQQQAQSSGCPVYFFAYPLTNEPCFLVDLQALLGQPVPEIPNPYYGQYAGPIGQIKTIQGVGPNNSIYAFSDVCVHLGCQLPAQVLVTSENNPGLDVTNSVLHCPCHGSLYSLMKGGVVVGGPAPRPLPIIFLEYDQNTGDIYAIGTNAPYFSASIPRTTPADNLLYDPRYSYSVPSNPSCSKGG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	252 (190)
Sequences:	136 (107)
Seq/√Len:	7.7

SULSO - Q97UN2 Q97V31 Q97VG6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
142_V	196_P	4.099	0.97
146_C	173_C	4.045	0.97
117_G	120_G	3.743	0.96
145_G	173_C	3.265	0.91
184_G	187_V	3.040	0.87
145_G	196_P	2.782	0.82
138_S	196_P	2.561	0.76
8_L	17_A	2.452	0.73
69_Q	72_A	2.423	0.72
135_Y	154_V	2.387	0.71
82_F	136_A	2.376	0.70
220_S	224_P	2.356	0.70
146_C	196_P	2.340	0.69
117_G	124_T	2.332	0.69
120_G	124_T	2.319	0.68
96_L	101_G	2.186	0.63
219_F	222_S	2.063	0.59
142_V	178_Y	2.044	0.58
16_A	19_A	1.981	0.55
173_C	196_P	1.960	0.55
169_L	180_L	1.956	0.54
96_L	103_P	1.915	0.53
23_L	70_Q	1.904	0.52
90_P	96_L	1.882	0.51
198_I	214_T	1.862	0.51
9_R	26_P	1.861	0.51
90_P	200_L	1.792	0.48
62_I	67_D	1.775	0.47
105_P	169_L	1.768	0.47
48_A	51_T	1.765	0.47
146_C	193_R	1.762	0.47
176_S	191_A	1.739	0.46
70_Q	91_C	1.699	0.44
81_F	207_G	1.696	0.44
57_F	62_I	1.690	0.44
46_L	51_T	1.668	0.43
126_Q	132_N	1.658	0.42
62_I	85_P	1.656	0.42
134_I	186_V	1.654	0.42
170_H	188_G	1.575	0.39
9_R	28_A	1.558	0.39
218_Y	221_A	1.454	0.35
17_A	136_A	1.454	0.35
173_C	193_R	1.420	0.33
18_V	66_K	1.406	0.33
201_E	212_I	1.385	0.32
170_H	175_G	1.379	0.32
178_Y	206_T	1.367	0.32
155_T	188_G	1.353	0.31
221_A	225_R	1.337	0.31
180_L	183_G	1.336	0.31
153_L	166_N	1.319	0.30
9_R	13_V	1.316	0.30
96_L	102_Q	1.304	0.29
99_L	102_Q	1.303	0.29
135_Y	180_L	1.290	0.29
82_F	90_P	1.288	0.29
69_Q	73_Q	1.284	0.29
148_L	184_G	1.282	0.29
145_G	193_R	1.274	0.28
58_P	196_P	1.274	0.28
206_T	210_Y	1.265	0.28
155_T	175_G	1.250	0.28
58_P	136_A	1.238	0.27
175_G	178_Y	1.231	0.27
58_P	86_L	1.216	0.27
4_R	169_L	1.199	0.26
62_I	90_P	1.193	0.26
96_L	216_A	1.181	0.25
175_G	215_N	1.178	0.25
104_V	108_P	1.176	0.25
188_G	191_A	1.162	0.25
96_L	105_P	1.145	0.24
200_L	212_I	1.131	0.24
134_I	209_I	1.119	0.24
141_C	171_C	1.102	0.23
143_H	171_C	1.102	0.23
135_Y	184_G	1.087	0.23
26_P	165_T	1.076	0.22
72_A	207_G	1.065	0.22
191_A	220_S	1.063	0.22
15_G	186_V	1.058	0.22
111_Y	148_L	1.053	0.22
220_S	223_I	1.050	0.22
19_A	178_Y	1.032	0.21
183_G	194_P	1.030	0.21
112_Y	203_D	1.027	0.21
74_S	196_P	1.025	0.21
82_F	85_P	1.019	0.21
48_A	91_C	1.019	0.21
17_A	111_Y	1.012	0.21
176_S	203_D	1.002	0.20
139_D	172_P	0.989	0.20
10_L	24_I	0.986	0.20
175_G	188_G	0.982	0.20
11_Y	172_P	0.973	0.20
146_C	175_G	0.969	0.20
154_V	180_L	0.958	0.19
93_L	117_G	0.957	0.19
136_A	195_L	0.950	0.19
142_V	188_G	0.948	0.19
116_A	200_L	0.946	0.19
216_A	220_S	0.942	0.19
48_A	89_E	0.930	0.19
169_L	184_G	0.930	0.19
155_T	170_H	0.930	0.19
177_L	186_V	0.926	0.18
142_V	175_G	0.925	0.18
72_A	79_V	0.921	0.18
53_G	71_Q	0.920	0.18
101_G	204_Q	0.918	0.18
73_Q	136_A	0.913	0.18
29_D	180_L	0.908	0.18
138_S	145_G	0.904	0.18
18_V	108_P	0.904	0.18
219_F	223_I	0.903	0.18
182_K	185_V	0.878	0.17
62_I	84_Y	0.877	0.17
179_S	186_V	0.877	0.17
221_A	224_P	0.868	0.17
5_R	143_H	0.867	0.17
5_R	141_C	0.867	0.17
5_R	171_C	0.867	0.17
137_F	184_G	0.863	0.17
148_L	169_L	0.847	0.17
153_L	193_R	0.844	0.17
170_H	173_C	0.843	0.17
103_P	134_I	0.840	0.16
68_I	164_V	0.834	0.16
8_L	154_V	0.832	0.16
92_F	178_Y	0.830	0.16
100_L	103_P	0.826	0.16
132_N	136_A	0.822	0.16
145_G	174_H	0.818	0.16
8_L	217_P	0.815	0.16
82_F	186_V	0.814	0.16
132_N	199_F	0.812	0.16
27_L	109_N	0.812	0.16
98_A	108_P	0.812	0.16
19_A	148_L	0.806	0.16
24_I	48_A	0.792	0.15
190_P	211_A	0.789	0.15
63_A	69_Q	0.787	0.15
153_L	172_P	0.784	0.15
62_I	216_A	0.777	0.15
131_N	182_K	0.775	0.15
154_V	174_H	0.767	0.15
82_F	200_L	0.764	0.15
59_K	88_N	0.764	0.15
101_G	104_V	0.759	0.15
63_A	68_I	0.757	0.15
64_N	69_Q	0.754	0.15
8_L	184_G	0.751	0.15
139_D	155_T	0.746	0.14
6_T	204_Q	0.740	0.14
12_L	193_R	0.736	0.14
134_I	184_G	0.734	0.14
23_L	59_K	0.732	0.14
108_P	177_L	0.731	0.14
147_Q	178_Y	0.730	0.14
28_A	137_F	0.725	0.14
202_Y	206_T	0.724	0.14
179_S	209_I	0.723	0.14
134_I	167_S	0.723	0.14
146_C	174_H	0.721	0.14
155_T	164_V	0.720	0.14
81_F	108_P	0.719	0.14
105_P	164_V	0.718	0.14
8_L	96_L	0.717	0.14
59_K	87_T	0.717	0.14
74_S	77_C	0.716	0.14
191_A	219_F	0.714	0.14
186_V	194_P	0.714	0.14
149_P	183_G	0.712	0.14
145_G	172_P	0.706	0.14
86_L	146_C	0.704	0.14
23_L	26_P	0.702	0.14
86_L	90_P	0.700	0.14
176_S	200_L	0.700	0.14
86_L	89_E	0.697	0.14
97_Q	103_P	0.695	0.14
90_P	102_Q	0.695	0.14
177_L	188_G	0.694	0.13
153_L	170_H	0.692	0.13
24_I	28_A	0.691	0.13
170_H	193_R	0.691	0.13
147_Q	211_A	0.690	0.13
59_K	213_G	0.687	0.13
133_S	167_S	0.686	0.13
13_V	52_D	0.680	0.13
58_P	173_C	0.680	0.13
81_F	88_N	0.678	0.13
7_F	17_A	0.675	0.13
10_L	61_R	0.674	0.13
103_P	107_I	0.672	0.13
183_G	213_G	0.669	0.13
178_Y	221_A	0.663	0.13
142_V	173_C	0.662	0.13
172_P	193_R	0.662	0.13
112_Y	118_P	0.660	0.13
74_S	78_P	0.652	0.13
173_C	190_P	0.650	0.13
22_P	187_V	0.649	0.13
149_P	175_G	0.649	0.13
172_P	223_I	0.644	0.13
144_L	169_L	0.643	0.13
82_F	94_V	0.643	0.13
3_N	93_L	0.637	0.12
62_I	69_Q	0.635	0.12
139_D	178_Y	0.634	0.12
178_Y	188_G	0.629	0.12
13_V	200_L	0.628	0.12
62_I	71_Q	0.625	0.12
92_F	139_D	0.624	0.12
16_A	212_I	0.623	0.12
219_F	225_R	0.620	0.12
69_Q	85_P	0.619	0.12
84_Y	183_G	0.619	0.12
75_S	78_P	0.615	0.12
149_P	214_T	0.612	0.12
116_A	216_A	0.606	0.12
61_R	67_D	0.604	0.12
143_H	195_L	0.604	0.12
141_C	195_L	0.604	0.12
171_C	195_L	0.604	0.12
85_P	89_E	0.603	0.12
53_G	87_T	0.602	0.12
107_I	112_Y	0.597	0.12
54_L	58_P	0.595	0.12
142_V	155_T	0.590	0.12
147_Q	202_Y	0.589	0.12
95_D	98_A	0.586	0.12
186_V	189_G	0.583	0.12
172_P	207_G	0.581	0.12
110_P	204_Q	0.579	0.11
174_H	196_P	0.575	0.11
93_L	96_L	0.572	0.11
141_C	189_G	0.572	0.11
143_H	189_G	0.572	0.11
171_C	189_G	0.572	0.11
84_Y	210_Y	0.571	0.11
78_P	82_F	0.568	0.11
145_G	175_G	0.568	0.11
103_P	209_I	0.567	0.11
144_L	149_P	0.564	0.11
154_V	184_G	0.562	0.11
202_Y	209_I	0.554	0.11
85_P	183_G	0.550	0.11
110_P	123_K	0.548	0.11
148_L	180_L	0.548	0.11
13_V	29_D	0.547	0.11
145_G	188_G	0.546	0.11
166_N	172_P	0.545	0.11
84_Y	90_P	0.541	0.11
53_G	123_K	0.540	0.11
187_V	213_G	0.539	0.11
178_Y	191_A	0.539	0.11
85_P	135_Y	0.538	0.11
6_T	182_K	0.536	0.11
155_T	178_Y	0.536	0.11
86_L	173_C	0.536	0.11
16_A	70_Q	0.535	0.11
142_V	198_I	0.532	0.11
74_S	85_P	0.531	0.11
14_V	18_V	0.529	0.11
135_Y	216_A	0.526	0.11
13_V	28_A	0.525	0.11
74_S	185_V	0.524	0.11
57_F	67_D	0.524	0.11
188_G	214_T	0.521	0.11
192_P	213_G	0.519	0.11
171_C	190_P	0.515	0.10
143_H	190_P	0.515	0.10
141_C	190_P	0.515	0.10
222_S	225_R	0.508	0.10
132_N	164_V	0.507	0.10
24_I	66_K	0.506	0.10
84_Y	91_C	0.505	0.10
7_F	89_E	0.504	0.10
45_Y	93_L	0.504	0.10
154_V	193_R	0.504	0.10
184_G	209_I	0.502	0.10
144_L	167_S	0.502	0.10
111_Y	180_L	0.501	0.10
56_G	212_I	0.500	0.10

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1jm1A	1	0.7619	100	0.599	Contact Map
4aayB	1	0.5238	100	0.668	Contact Map
4ogqD	1	0.6389	99.9	0.741	Contact Map
2qjyC	2	0.6746	99.8	0.76	Contact Map
3cx5E	1	0.6468	99.8	0.766	Contact Map
4d6tE	1	0.1667	99.8	0.773	Contact Map
1nykA	1	0.5913	99.8	0.774	Contact Map
1pp9E	1	0.6508	99.8	0.775	Contact Map
1g8kB	1	0.5278	99.7	0.788	Contact Map
1rieA	1	0.5	99.5	0.819	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.