Q97UG9 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97UG9 - Uncharacterized protein

UniProt:	Q97UG9	Sequences: MFLSSMKLGIQSYSLRKLTYENALKVMSELGISYVEAFPRHLPPSSNSVKDIINLHKENGVKVIAHGVNHLKSDKKELRSIFDFANKVEIEVITADPDEDCLNLMSDLVKEYDIKVAIHNHGPYHRWGSYKKIYEFTKNLDYRVGMCLDLAHLFRYGENPIEAVNTLRDRIHDIHVKDVNNKGEDVIVGSGILDVKGVIGKVKELNLDIPLMIEYEPEPENPLPGIVKSLEYVKKLL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	237 (214)
Sequences:	13877 (9994)
Seq/√Len:	683.2

ECOLI - ULAE SGBU YCJR FRLC YIHM YGBM HYI
BACSU - YFIH IOLH IOLI IOLE
SULSO - Q97UG9 Q97UI8 Q97UI3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
79_R	108_L	3.097	1.00
145_G	172_H	3.051	1.00
25_K	59_N	3.025	1.00
194_D	197_G	2.885	1.00
53_I	57_K	2.827	1.00
83_D	112_Y	2.598	1.00
165_N	201_K	2.573	1.00
34_Y	210_P	2.549	1.00
99_E	139_N	2.444	1.00
21_E	55_L	2.321	1.00
115_K	145_G	2.275	1.00
19_T	22_N	2.242	1.00
178_D	189_G	2.238	1.00
83_D	108_L	2.230	1.00
54_N	58_E	2.209	1.00
117_A	172_H	2.182	1.00
115_K	172_H	2.156	1.00
86_N	112_Y	2.107	1.00
134_Y	166_T	2.002	1.00
56_H	63_V	1.883	1.00
135_E	139_N	1.880	1.00
201_K	204_E	1.857	1.00
25_K	29_E	1.847	1.00
75_K	104_L	1.826	1.00
55_L	59_N	1.807	1.00
106_S	144_V	1.794	1.00
92_V	117_A	1.787	1.00
110_K	143_R	1.759	1.00
55_L	58_E	1.756	1.00
165_N	204_E	1.749	1.00
159_N	162_E	1.738	1.00
82_F	112_Y	1.731	1.00
49_V	87_K	1.699	1.00
50_K	87_K	1.698	1.00
196_K	200_G	1.666	1.00
108_L	111_E	1.651	1.00
48_S	51_D	1.639	1.00
117_A	147_C	1.635	1.00
174_I	202_V	1.588	1.00
161_I	197_G	1.581	1.00
108_L	112_Y	1.548	1.00
221_N	224_P	1.535	1.00
82_F	109_V	1.520	1.00
178_D	191_G	1.518	1.00
72_K	76_K	1.509	1.00
21_E	58_E	1.487	1.00
99_E	103_N	1.476	1.00
107_D	111_E	1.469	1.00
85_A	90_I	1.464	1.00
28_S	59_N	1.446	1.00
134_Y	138_K	1.422	1.00
24_L	59_N	1.419	1.00
200_G	204_E	1.404	1.00
76_K	80_S	1.399	1.00
162_E	166_T	1.390	1.00
26_V	29_E	1.362	1.00
129_S	132_K	1.360	1.00
51_D	54_N	1.354	1.00
106_S	140_L	1.354	1.00
82_F	108_L	1.354	1.00
100_D	103_N	1.352	1.00
201_K	205_L	1.342	1.00
80_S	83_D	1.337	1.00
25_K	55_L	1.336	1.00
22_N	25_K	1.335	1.00
145_G	170_R	1.326	1.00
26_V	223_L	1.324	1.00
190_S	228_K	1.320	1.00
150_L	198_V	1.300	1.00
75_K	79_R	1.297	1.00
168_R	205_L	1.297	1.00
92_V	115_K	1.286	1.00
76_K	79_R	1.284	1.00
53_I	87_K	1.275	1.00
131_K	166_T	1.266	1.00
79_R	104_L	1.253	1.00
99_E	140_L	1.251	1.00
138_K	170_R	1.245	1.00
224_P	228_K	1.244	1.00
109_V	116_V	1.230	1.00
134_Y	170_R	1.222	1.00
133_I	146_M	1.203	1.00
104_L	107_D	1.185	1.00
51_D	55_L	1.171	1.00
24_L	56_H	1.168	1.00
128_G	132_K	1.165	1.00
113_D	143_R	1.162	1.00
54_N	57_K	1.162	1.00
197_G	201_K	1.155	1.00
28_S	60_G	1.149	1.00
79_R	111_E	1.148	1.00
79_R	83_D	1.147	1.00
110_K	142_Y	1.146	1.00
34_Y	64_I	1.140	1.00
26_V	30_L	1.133	1.00
187_I	190_S	1.121	1.00
135_E	138_K	1.118	1.00
32_I	213_I	1.107	1.00
165_N	205_L	1.106	1.00
82_F	114_I	1.100	1.00
49_V	84_F	1.095	1.00
202_V	205_L	1.089	1.00
34_Y	62_K	1.089	1.00
21_E	51_D	1.076	1.00
27_M	35_V	1.076	1.00
162_E	165_N	1.069	1.00
37_A	63_V	1.069	1.00
107_D	110_K	1.062	1.00
46_S	87_K	1.056	1.00
103_N	140_L	1.052	1.00
72_K	104_L	1.049	1.00
10_I	27_M	1.049	1.00
50_K	54_N	1.048	1.00
134_Y	167_L	1.037	1.00
24_L	55_L	1.034	1.00
56_H	61_V	1.025	1.00
161_I	165_N	1.020	1.00
223_L	227_V	1.014	1.00
164_V	205_L	1.003	1.00
163_A	167_L	1.003	1.00
103_N	107_D	0.995	1.00
148_L	153_L	0.992	1.00
78_L	105_M	0.990	1.00
91_E	115_K	0.964	1.00
106_S	143_R	0.961	1.00
49_V	53_I	0.960	1.00
92_V	172_H	0.954	1.00
29_E	223_L	0.948	1.00
193_L	198_V	0.946	1.00
83_D	86_N	0.940	1.00
66_H	85_A	0.938	1.00
83_D	87_K	0.916	1.00
75_K	101_C	0.914	1.00
120_N	153_L	0.912	1.00
36_E	173_D	0.911	1.00
21_E	25_K	0.910	1.00
119_H	214_E	0.908	1.00
149_D	214_E	0.903	1.00
102_L	144_V	0.901	1.00
164_V	201_K	0.895	1.00
79_R	112_Y	0.894	1.00
176_V	195_V	0.888	1.00
85_A	93_I	0.887	1.00
56_H	59_N	0.885	1.00
161_I	201_K	0.884	1.00
73_S	76_K	0.883	1.00
28_S	33_S	0.880	1.00
43_P	46_S	0.880	1.00
131_K	135_E	0.873	1.00
25_K	58_E	0.871	1.00
49_V	88_V	0.869	1.00
224_P	227_V	0.868	1.00
36_E	65_A	0.868	1.00
103_N	141_D	0.861	1.00
64_I	210_P	0.860	1.00
32_I	226_I	0.859	1.00
151_A	177_K	0.855	1.00
115_K	143_R	0.850	1.00
177_K	216_E	0.850	1.00
140_L	144_V	0.847	1.00
152_H	177_K	0.823	1.00
146_M	167_L	0.821	1.00
199_I	211_L	0.819	1.00
199_I	203_K	0.817	1.00
86_N	114_I	0.815	1.00
77_E	80_S	0.812	1.00
50_K	53_I	0.812	1.00
197_G	200_G	0.808	1.00
105_M	116_V	0.804	1.00
180_N	192_I	0.799	1.00
181_N	192_I	0.798	1.00
130_Y	158_E	0.793	1.00
103_N	139_N	0.789	1.00
84_F	88_V	0.780	1.00
63_V	90_I	0.778	1.00
62_K	91_E	0.776	1.00
176_V	211_L	0.775	1.00
132_K	135_E	0.769	1.00
225_G	228_K	0.763	1.00
33_S	62_K	0.763	1.00
137_T	170_R	0.761	1.00
154_F	192_I	0.760	1.00
195_V	199_I	0.760	1.00
47_N	51_D	0.760	1.00
24_L	35_V	0.759	1.00
100_D	104_L	0.757	1.00
13_Y	16_R	0.757	1.00
36_E	212_M	0.753	1.00
220_E	224_P	0.752	1.00
137_T	146_M	0.751	1.00
150_L	195_V	0.749	1.00
106_S	110_K	0.746	1.00
164_V	171_I	0.746	1.00
94_T	121_H	0.745	1.00
206_N	209_I	0.744	1.00
21_E	59_N	0.737	1.00
95_A	116_V	0.731	1.00
24_L	61_V	0.730	1.00
151_A	179_V	0.717	1.00
62_K	210_P	0.717	1.00
222_P	225_G	0.717	1.00
104_L	108_L	0.711	1.00
180_N	186_V	0.711	1.00
148_L	164_V	0.709	1.00
148_L	163_A	0.709	1.00
177_K	185_D	0.708	1.00
75_K	105_M	0.707	1.00
18_L	26_V	0.698	1.00
173_D	212_M	0.697	1.00
101_C	104_L	0.697	1.00
22_N	26_V	0.693	1.00
154_F	160_P	0.692	1.00
123_P	156_Y	0.691	1.00
120_N	127_W	0.688	1.00
28_S	61_V	0.682	1.00
137_T	141_D	0.682	1.00
130_Y	166_T	0.673	1.00
94_T	147_C	0.672	1.00
120_N	133_I	0.671	1.00
130_Y	134_Y	0.667	1.00
74_D	77_E	0.665	1.00
80_S	84_F	0.661	1.00
23_A	27_M	0.659	1.00
168_R	171_I	0.655	1.00
164_V	168_R	0.655	1.00
107_D	143_R	0.655	1.00
153_L	163_A	0.650	1.00
93_I	109_V	0.650	1.00
10_I	226_I	0.647	1.00
220_E	228_K	0.646	1.00
75_K	108_L	0.639	1.00
92_V	173_D	0.632	1.00
119_H	175_H	0.632	1.00
121_H	177_K	0.631	1.00
53_I	89_E	0.630	1.00
174_I	211_L	0.629	1.00
203_K	211_L	0.629	1.00
186_V	190_S	0.625	1.00
75_K	78_L	0.624	1.00
25_K	28_S	0.622	1.00
185_D	188_V	0.621	1.00
127_W	133_I	0.619	1.00
187_I	225_G	0.619	1.00
164_V	167_L	0.617	1.00
15_L	26_V	0.617	1.00
24_L	52_I	0.616	1.00
167_L	171_I	0.615	1.00
78_L	82_F	0.614	1.00
73_S	77_E	0.612	1.00
169_D	205_L	0.611	1.00
164_V	198_V	0.611	1.00
56_H	60_G	0.610	1.00
168_R	201_K	0.608	1.00
99_E	136_F	0.608	1.00
147_C	173_D	0.606	1.00
27_M	32_I	0.602	1.00
148_L	171_I	0.602	1.00
30_L	227_V	0.595	1.00
175_H	212_M	0.591	1.00
102_L	106_S	0.590	1.00
188_V	191_G	0.590	1.00
66_H	90_I	0.590	1.00
149_D	177_K	0.589	1.00
57_K	87_K	0.586	1.00
68_V	71_L	0.584	1.00
15_L	18_L	0.582	1.00
109_V	114_I	0.577	1.00
203_K	206_N	0.570	1.00
68_V	81_I	0.570	1.00
122_G	155_R	0.565	1.00
102_L	136_F	0.565	1.00
10_I	15_L	0.564	1.00
81_I	93_I	0.561	1.00
154_F	193_L	0.560	1.00
89_E	114_I	0.560	1.00
119_H	152_H	0.560	1.00
215_Y	225_G	0.555	1.00
173_D	207_L	0.554	1.00
141_D	170_R	0.552	1.00
136_F	140_L	0.550	1.00
43_P	80_S	0.549	1.00
86_N	113_D	0.549	1.00
37_A	52_I	0.549	1.00
134_Y	137_T	0.547	1.00
65_A	94_T	0.545	1.00
64_I	212_M	0.544	1.00
146_M	171_I	0.543	1.00
85_A	114_I	0.541	1.00
46_S	50_K	0.540	1.00
127_W	136_F	0.540	1.00
174_I	198_V	0.536	1.00
164_V	202_V	0.536	1.00
95_A	102_L	0.535	1.00
57_K	89_E	0.535	1.00
150_L	176_V	0.528	1.00
138_K	166_T	0.527	1.00
24_L	28_S	0.527	1.00
63_V	66_H	0.524	1.00
52_I	55_L	0.523	1.00
67_G	70_H	0.521	1.00
12_S	15_L	0.520	0.99
221_N	225_G	0.519	0.99
117_A	145_G	0.517	0.99
155_R	179_V	0.517	0.99
12_S	17_K	0.514	0.99
106_S	116_V	0.513	0.99
15_L	223_L	0.513	0.99
29_E	227_V	0.510	0.99
77_E	81_I	0.510	0.99
20_Y	52_I	0.508	0.99
53_I	88_V	0.508	0.99
153_L	158_E	0.505	0.99
133_I	137_T	0.504	0.99
119_H	149_D	0.503	0.99
154_F	158_E	0.502	0.99
202_V	207_L	0.502	0.99
174_I	207_L	0.502	0.99
10_I	14_S	0.502	0.99
121_H	216_E	0.501	0.99
133_I	153_L	0.501	0.99
109_V	112_Y	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3lmzA	2	0.9958	100	0.218	Contact Map
4kw2A	5	0.9578	100	0.22	Contact Map
3p6lA	2	0.9958	100	0.221	Contact Map
2zdsA	5	0.9747	100	0.233	Contact Map
1i60A	1	0.9705	100	0.245	Contact Map
3cnyA	1	0.9705	100	0.25	Contact Map
3u0hA	3	0.9789	100	0.257	Contact Map
3dx5A	2	0.9536	100	0.259	Contact Map
3cqjA	2	0.9747	100	0.26	Contact Map
2q02A	2	0.9789	100	0.261	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0088 seconds.