Q97UF8 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97UF8 - Uncharacterized protein

UniProt:	Q97UF8	Sequences: MGFRVSKYRYSSISNSKRPLVKSFKTVEDVHGKGGVGNEIVKPIRLKAQSKHAFDAITELCETYFKVLEFLAISPLTNLALAYLKYPRLTECIHHLYIMGGTIYGRGNITPIAEYNFWVDQMQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	123 (117)
Sequences:	3116 (2163)
Seq/√Len:	200.0

ECOLI - RIHA RIHC RIHB
SULSO - Q97UF8 Q97WH6 Q97ZS5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
51_K	59_E	3.761	1.00
55_D	85_K	3.543	1.00
16_S	81_L	2.596	1.00
62_E	86_Y	2.374	1.00
62_E	92_C	2.281	1.00
13_I	56_A	2.257	1.00
13_I	49_Q	2.196	1.00
72_A	79_L	2.014	1.00
83_Y	90_T	2.007	1.00
72_A	98_I	1.984	1.00
59_E	63_T	1.979	1.00
56_A	60_L	1.960	1.00
69_E	97_Y	1.948	1.00
58_T	86_Y	1.918	1.00
62_E	88_R	1.891	1.00
67_V	94_H	1.873	1.00
72_A	76_L	1.749	1.00
98_I	117_F	1.748	1.00
61_C	68_L	1.679	1.00
22_K	122_M	1.621	1.00
82_A	86_Y	1.593	1.00
52_H	55_D	1.590	1.00
69_E	95_H	1.579	1.00
60_L	63_T	1.531	1.00
102_T	105_G	1.529	1.00
18_R	84_L	1.497	1.00
58_T	89_L	1.486	1.00
61_C	92_C	1.461	1.00
34_G	37_G	1.451	1.00
52_H	85_K	1.430	1.00
58_T	82_A	1.425	1.00
110_T	113_A	1.415	1.00
32_G	35_G	1.407	1.00
65_F	92_C	1.392	1.00
76_L	98_I	1.391	1.00
100_G	117_F	1.378	1.00
31_H	35_G	1.369	1.00
115_Y	119_V	1.361	1.00
64_Y	67_V	1.358	1.00
79_L	96_L	1.345	1.00
86_Y	89_L	1.343	1.00
34_G	40_I	1.337	1.00
46_L	49_Q	1.318	1.00
21_V	122_M	1.306	1.00
82_A	89_L	1.288	1.00
75_P	119_V	1.283	1.00
20_L	80_A	1.256	1.00
70_F	93_I	1.255	1.00
57_I	82_A	1.244	1.00
61_C	93_I	1.193	1.00
58_T	62_E	1.173	1.00
14_S	48_A	1.155	1.00
61_C	89_L	1.121	1.00
54_F	85_K	1.119	1.00
34_G	38_N	1.108	1.00
25_K	118_W	1.093	1.00
13_I	51_K	1.069	1.00
88_R	91_E	1.058	1.00
55_D	59_E	1.052	1.00
53_A	78_N	1.046	1.00
76_L	117_F	1.046	1.00
81_L	84_L	1.043	1.00
113_A	118_W	1.034	1.00
91_E	94_H	1.027	1.00
61_C	82_A	1.024	1.00
29_D	109_I	1.009	1.00
57_I	89_L	1.000	1.00
57_I	79_L	0.990	1.00
61_C	64_Y	0.981	1.00
32_G	37_G	0.967	0.99
33_K	38_N	0.967	0.99
69_E	94_H	0.965	0.99
70_F	79_L	0.953	0.99
54_F	82_A	0.921	0.99
73_I	98_I	0.912	0.99
34_G	41_V	0.911	0.99
60_L	68_L	0.910	0.99
14_S	17_K	0.905	0.99
109_I	118_W	0.870	0.99
16_S	77_T	0.859	0.99
20_L	81_L	0.855	0.99
57_I	61_C	0.855	0.99
24_F	119_V	0.851	0.99
27_V	30_V	0.849	0.99
56_A	59_E	0.841	0.99
107_G	113_A	0.826	0.98
61_C	90_T	0.820	0.98
21_V	84_L	0.818	0.98
102_T	106_R	0.805	0.98
70_F	96_L	0.798	0.98
110_T	118_W	0.795	0.98
67_V	92_C	0.789	0.98
54_F	81_L	0.788	0.98
72_A	96_L	0.786	0.98
34_G	39_E	0.779	0.98
30_V	115_Y	0.779	0.98
16_S	52_H	0.776	0.97
26_T	119_V	0.748	0.97
20_L	84_L	0.745	0.97
31_H	36_V	0.726	0.96
18_R	23_S	0.725	0.96
90_T	93_I	0.716	0.96
7_K	10_Y	0.713	0.96
71_L	122_M	0.710	0.96
83_Y	93_I	0.703	0.96
11_S	49_Q	0.699	0.95
55_D	58_T	0.686	0.95
112_I	118_W	0.676	0.94
61_C	86_Y	0.672	0.94
57_I	70_F	0.670	0.94
64_Y	68_L	0.668	0.94
30_V	38_N	0.660	0.94
27_V	115_Y	0.657	0.94
45_R	48_A	0.656	0.94
31_H	37_G	0.655	0.94
106_R	112_I	0.640	0.93
52_H	81_L	0.638	0.93
14_S	52_H	0.635	0.92
60_L	64_Y	0.630	0.92
103_I	106_R	0.629	0.92
65_F	68_L	0.628	0.92
58_T	88_R	0.617	0.91
64_Y	92_C	0.614	0.91
6_S	9_R	0.613	0.91
35_G	38_N	0.613	0.91
17_K	84_L	0.609	0.91
108_N	113_A	0.606	0.91
66_K	92_C	0.604	0.90
58_T	85_K	0.600	0.90
79_L	93_I	0.600	0.90
66_K	94_H	0.600	0.90
22_K	25_K	0.597	0.90
16_S	78_N	0.596	0.90
63_T	66_K	0.584	0.89
28_E	33_K	0.583	0.89
83_Y	89_L	0.583	0.89
56_A	115_Y	0.579	0.89
89_L	92_C	0.576	0.88
11_S	56_A	0.568	0.88
67_V	83_Y	0.567	0.88
8_Y	11_S	0.564	0.87
86_Y	92_C	0.564	0.87
18_R	25_K	0.560	0.87
19_P	22_K	0.556	0.87
36_V	39_E	0.555	0.86
72_A	78_N	0.553	0.86
91_E	95_H	0.548	0.86
71_L	97_Y	0.548	0.86
55_D	86_Y	0.548	0.86
22_K	118_W	0.547	0.86
24_F	30_V	0.545	0.85
38_N	115_Y	0.544	0.85
41_V	44_I	0.541	0.85
9_R	46_L	0.537	0.85
76_L	79_L	0.535	0.84
51_K	55_D	0.534	0.84
44_I	48_A	0.533	0.84
78_N	82_A	0.532	0.84
8_Y	46_L	0.532	0.84
81_L	85_K	0.528	0.84
21_V	81_L	0.528	0.84
37_G	109_I	0.525	0.83
77_T	81_L	0.525	0.83
102_T	114_E	0.522	0.83
109_I	119_V	0.518	0.82
102_T	107_G	0.516	0.82
71_L	104_Y	0.516	0.82
16_S	20_L	0.515	0.82
53_A	82_A	0.513	0.82
47_K	50_S	0.513	0.82
18_R	24_F	0.510	0.81
20_L	77_T	0.506	0.81
49_Q	59_E	0.504	0.81
105_G	112_I	0.503	0.81
68_L	95_H	0.501	0.80
27_V	31_H	0.500	0.80

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4kpnA	2	1	100	0.117	Contact Map
3t8jA	3	0.9919	100	0.119	Contact Map
4kpoA	2	1	100	0.121	Contact Map
4wr2A	4	0.9106	100	0.124	Contact Map
3t8iA	3	0.9919	100	0.129	Contact Map
2masA	3	0.9919	100	0.13	Contact Map
1q8fA	4	0.9837	100	0.137	Contact Map
3fz0A	3	0.9837	100	0.153	Contact Map
4kl0A	1	0.9431	100	0.177	Contact Map
2c40A	2	0.9431	100	0.222	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.