Q97UD7 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97UD7 - Uncharacterized protein

UniProt:	Q97UD7	Sequences: MIRSYNVVLSHEDWTLLTDKYDEEDLRVLMKIRTPSFEKMEENIIAEAYVRDPLILNELINIIKSNNRVTRVKIIENVRTKNELRALILLSAKLRGGISELLMNKGAYYISERISNGLEKWSLVIDDKIFREIILPTLKEYTYSLKIIEKDDGNLVSVKNLLTSKEFEIIYKAYKMGYFDWPKKVDLKELSEELGISKAATLQALRRAMGKLIRNYVDNLV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	221 (200)
Sequences:	1861 (1527)
Seq/√Len:	108.0

HALSA - Q9HSM9 Q9HR58 Q9HSR5 O54637 Q9HQD9 Q9HPS7 DMSR Q9HQU9
SULSO - Q97UD7 Q97Y14 Q97YL7 Q97UC0 Q97WR0 Q7LXI8 Q97YT8 Q97ZB6 Q97X87 Q97ZX5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
179_F	209_M	4.287	1.00
185_V	190_L	4.076	1.00
172_K	176_M	3.709	1.00
102_L	107_A	3.299	1.00
169_I	194_L	3.250	1.00
200_A	204_A	3.105	1.00
180_D	184_K	3.046	1.00
176_M	190_L	2.972	1.00
185_V	189_E	2.943	1.00
197_S	200_A	2.923	1.00
107_A	125_I	2.874	1.00
172_K	190_L	2.827	1.00
176_M	193_E	2.727	1.00
84_L	87_L	2.562	1.00
174_Y	214_R	2.557	1.00
86_A	89_L	2.522	1.00
165_K	204_A	2.506	1.00
186_D	189_E	2.470	1.00
187_L	201_T	2.308	1.00
85_R	88_I	2.241	1.00
165_K	168_E	2.193	1.00
22_D	117_G	2.189	1.00
181_W	202_L	2.175	1.00
165_K	169_I	1.981	1.00
26_L	32_I	1.926	1.00
10_S	118_L	1.832	1.00
48_A	59_L	1.813	1.00
187_L	202_L	1.789	1.00
84_L	88_I	1.772	1.00
198_K	202_L	1.730	1.00
196_I	201_T	1.684	1.00
204_A	207_R	1.657	1.00
213_I	216_Y	1.653	1.00
85_R	89_L	1.651	1.00
169_I	204_A	1.645	1.00
170_I	213_I	1.616	1.00
167_F	171_Y	1.607	1.00
190_L	201_T	1.603	1.00
56_L	59_L	1.567	1.00
32_I	35_P	1.567	1.00
88_I	91_S	1.552	1.00
183_K	206_R	1.547	1.00
55_I	58_E	1.543	1.00
174_Y	217_V	1.425	1.00
169_I	190_L	1.406	1.00
181_W	203_Q	1.385	1.00
34_T	37_F	1.384	1.00
110_I	124_V	1.371	1.00
203_Q	207_R	1.370	1.00
91_S	96_G	1.359	1.00
170_I	179_F	1.350	1.00
169_I	196_I	1.287	0.99
69_V	72_V	1.285	0.99
177_G	184_K	1.284	0.99
73_K	185_V	1.240	0.99
21_Y	66_N	1.238	0.99
204_A	211_K	1.236	0.99
185_V	193_E	1.216	0.99
212_L	216_Y	1.206	0.99
56_L	60_I	1.205	0.99
74_I	86_A	1.196	0.99
89_L	92_A	1.188	0.99
179_F	205_L	1.136	0.98
200_A	203_Q	1.136	0.98
25_D	28_V	1.126	0.98
60_I	72_V	1.115	0.98
58_E	61_N	1.106	0.98
181_W	204_A	1.105	0.98
100_E	104_N	1.098	0.98
187_L	204_A	1.088	0.98
128_K	197_S	1.087	0.98
176_M	185_V	1.082	0.98
200_A	205_L	1.079	0.98
9_L	123_L	1.076	0.98
30_M	33_R	1.064	0.97
120_K	148_I	1.061	0.97
181_W	199_A	1.060	0.97
86_A	92_A	1.051	0.97
200_A	208_A	1.050	0.97
192_E	195_G	1.049	0.97
174_Y	179_F	1.043	0.97
28_V	32_I	1.029	0.97
169_I	201_T	1.018	0.97
180_D	210_G	1.017	0.97
210_G	214_R	1.003	0.96
58_E	192_E	1.003	0.96
26_L	29_L	1.002	0.96
190_L	194_L	0.998	0.96
10_S	148_I	0.983	0.96
97_G	100_E	0.979	0.96
17_L	21_Y	0.977	0.96
31_K	47_E	0.975	0.96
26_L	30_M	0.970	0.96
187_L	198_K	0.970	0.96
162_L	208_A	0.965	0.96
181_W	206_R	0.955	0.95
129_I	132_E	0.953	0.95
178_Y	187_L	0.953	0.95
92_A	96_G	0.951	0.95
189_E	192_E	0.950	0.95
16_L	19_D	0.949	0.95
17_L	20_K	0.944	0.95
169_I	208_A	0.943	0.95
107_A	111_S	0.941	0.95
75_I	114_I	0.919	0.94
26_L	31_K	0.913	0.94
165_K	203_Q	0.908	0.94
111_S	179_F	0.906	0.94
9_L	135_L	0.902	0.94
199_A	203_Q	0.901	0.94
194_L	201_T	0.895	0.93
213_I	217_V	0.886	0.93
46_A	91_S	0.883	0.93
109_Y	132_E	0.882	0.93
188_K	198_K	0.878	0.93
13_D	16_L	0.872	0.92
178_Y	183_K	0.869	0.92
25_D	35_P	0.867	0.92
188_K	206_R	0.864	0.92
132_E	136_P	0.862	0.92
147_I	150_K	0.862	0.92
132_E	184_K	0.862	0.92
26_L	35_P	0.855	0.92
198_K	207_R	0.852	0.92
28_V	34_T	0.851	0.92
113_R	120_K	0.851	0.92
166_E	211_K	0.850	0.91
171_Y	175_K	0.848	0.91
125_I	179_F	0.847	0.91
181_W	210_G	0.844	0.91
32_I	36_S	0.841	0.91
26_L	34_T	0.840	0.91
110_I	122_S	0.834	0.91
197_S	206_R	0.829	0.90
150_K	178_Y	0.827	0.90
191_S	201_T	0.824	0.90
205_L	209_M	0.816	0.90
109_Y	123_L	0.810	0.89
99_S	109_Y	0.810	0.89
11_H	16_L	0.807	0.89
64_K	72_V	0.805	0.89
125_I	146_K	0.797	0.89
208_A	213_I	0.788	0.88
107_A	112_E	0.784	0.88
179_F	208_A	0.784	0.88
10_S	146_K	0.783	0.88
55_I	116_N	0.782	0.88
13_D	17_L	0.781	0.88
172_K	193_E	0.773	0.87
42_E	93_K	0.771	0.87
124_V	179_F	0.768	0.87
135_L	145_L	0.767	0.87
161_L	215_N	0.762	0.86
25_D	32_I	0.762	0.86
25_D	31_K	0.761	0.86
108_Y	124_V	0.759	0.86
133_I	203_Q	0.758	0.86
136_P	140_E	0.758	0.86
165_K	209_M	0.754	0.86
58_E	62_I	0.753	0.86
114_I	119_E	0.753	0.86
44_I	47_E	0.752	0.86
181_W	188_K	0.752	0.86
200_A	216_Y	0.751	0.86
91_S	94_L	0.748	0.85
33_R	36_S	0.745	0.85
79_R	84_L	0.740	0.85
170_I	217_V	0.739	0.85
48_A	52_D	0.737	0.84
58_E	72_V	0.733	0.84
179_F	187_L	0.732	0.84
133_I	136_P	0.726	0.84
47_E	135_L	0.722	0.83
138_L	143_Y	0.721	0.83
9_L	121_W	0.715	0.83
168_E	171_Y	0.714	0.83
19_D	22_D	0.713	0.82
22_D	118_L	0.709	0.82
182_P	206_R	0.708	0.82
85_R	92_A	0.708	0.82
207_R	210_G	0.706	0.82
107_A	110_I	0.705	0.82
133_I	198_K	0.703	0.82
99_S	201_T	0.702	0.81
30_M	34_T	0.698	0.81
37_F	195_G	0.697	0.81
105_K	137_T	0.697	0.81
93_K	96_G	0.690	0.80
14_W	19_D	0.688	0.80
70_T	73_K	0.686	0.80
168_E	172_K	0.685	0.80
14_W	56_L	0.684	0.80
166_E	204_A	0.684	0.80
176_M	201_T	0.683	0.80
32_I	37_F	0.678	0.79
181_W	200_A	0.678	0.79
172_K	185_V	0.677	0.79
143_Y	204_A	0.675	0.79
146_K	180_D	0.674	0.79
172_K	194_L	0.674	0.79
71_R	74_I	0.674	0.79
8_V	17_L	0.672	0.79
212_L	215_N	0.669	0.78
61_N	65_S	0.666	0.78
15_T	196_I	0.665	0.78
43_N	148_I	0.664	0.78
106_G	137_T	0.657	0.77
123_L	127_D	0.655	0.77
109_Y	147_I	0.653	0.77
60_I	77_N	0.646	0.76
45_I	112_E	0.646	0.76
20_K	98_I	0.646	0.76
178_Y	212_L	0.646	0.76
31_K	140_E	0.642	0.75
95_R	132_E	0.639	0.75
131_R	135_L	0.638	0.75
167_F	215_N	0.635	0.75
25_D	30_M	0.633	0.74
108_Y	201_T	0.630	0.74
16_L	98_I	0.629	0.74
48_A	62_I	0.626	0.74
130_F	149_E	0.624	0.73
185_V	206_R	0.622	0.73
101_L	186_D	0.621	0.73
207_R	212_L	0.619	0.73
108_Y	206_R	0.618	0.73
23_E	117_G	0.617	0.72
68_R	209_M	0.614	0.72
99_S	147_I	0.614	0.72
196_I	199_A	0.613	0.72
146_K	154_N	0.610	0.72
211_K	215_N	0.606	0.71
43_N	108_Y	0.604	0.71
44_I	119_E	0.599	0.70
145_L	202_L	0.598	0.70
86_A	91_S	0.598	0.70
157_S	200_A	0.598	0.70
13_D	19_D	0.595	0.70
91_S	95_R	0.594	0.70
178_Y	205_L	0.592	0.69
123_L	133_I	0.592	0.69
63_I	208_A	0.589	0.69
148_I	152_D	0.588	0.69
103_M	190_L	0.587	0.69
99_S	209_M	0.587	0.69
177_G	202_L	0.587	0.69
42_E	72_V	0.585	0.68
137_T	141_Y	0.584	0.68
194_L	202_L	0.582	0.68
52_D	61_N	0.576	0.67
101_L	104_N	0.575	0.67
84_L	92_A	0.573	0.67
200_A	207_R	0.571	0.67
59_L	63_I	0.571	0.67
149_E	190_L	0.571	0.67
65_S	157_S	0.571	0.67
115_S	118_L	0.571	0.67
18_T	119_E	0.570	0.66
44_I	109_Y	0.569	0.66
75_I	126_D	0.568	0.66
171_Y	217_V	0.566	0.66
46_A	88_I	0.565	0.66
148_I	210_G	0.565	0.66
94_L	101_L	0.562	0.65
133_I	143_Y	0.556	0.65
9_L	12_E	0.555	0.64
24_E	140_E	0.554	0.64
155_L	180_D	0.554	0.64
201_T	212_L	0.553	0.64
135_L	200_A	0.553	0.64
102_L	123_L	0.552	0.64
91_S	104_N	0.551	0.64
139_K	196_I	0.543	0.63
13_D	18_T	0.541	0.62
99_S	208_A	0.541	0.62
143_Y	207_R	0.540	0.62
44_I	91_S	0.538	0.62
64_K	132_E	0.536	0.62
186_D	216_Y	0.533	0.61
177_G	180_D	0.531	0.61
88_I	129_I	0.529	0.61
20_K	68_R	0.528	0.61
130_F	150_K	0.523	0.60
119_E	200_A	0.522	0.60
111_S	124_V	0.520	0.59
100_E	106_G	0.520	0.59
11_H	145_L	0.520	0.59
110_I	199_A	0.519	0.59
21_Y	68_R	0.517	0.59
112_E	121_W	0.514	0.59
73_K	89_L	0.513	0.58
139_K	184_K	0.512	0.58
131_R	146_K	0.512	0.58
120_K	191_S	0.512	0.58
88_I	137_T	0.509	0.58
27_R	32_I	0.506	0.57
102_L	121_W	0.506	0.57
179_F	213_I	0.505	0.57
98_I	102_L	0.505	0.57
36_S	130_F	0.500	0.57

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4wszA	2	0.2579	97.6	0.837	Contact Map
1ku3A	1	0.2715	97.5	0.84	Contact Map
1je8A	2	0.2624	97.3	0.845	Contact Map
1s7oA	3	0.3167	97.3	0.846	Contact Map
3c57A	2	0.2308	97.3	0.846	Contact Map
1fseA	2	0.267	97.2	0.847	Contact Map
1x3uA	1	0.3077	97.2	0.848	Contact Map
4g6dA	1	0.2805	97	0.852	Contact Map
1xsvA	2	0.3167	97	0.852	Contact Map
1p4wA	1	0.3348	97	0.852	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0078 seconds.