Q97UA8 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97UA8 - Uncharacterized protein

UniProt:	Q97UA8	Sequences: MMLNRTKVSGYLILVGVSQFLLFFIISEILYPNYSVKYNYISDLGVGKTAIIFNTSIVIMGILVIIASILLRANYSPLVFLVGLGAALVGIFPENTGLPHLIASLITFLFGGIGALVTSIKRNYFWGILGIATLVSLILFILKDYGPLGPGGLERMIVYPEIIWGISFATYLTR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	174 (165)
Sequences:	228 (195)
Seq/√Len:	15.2

SULSO - Q97UA8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
65_I	83_G	4.541	1.00
19_Q	56_S	4.110	1.00
41_I	158_V	3.732	1.00
53_F	57_I	3.652	1.00
41_I	154_E	3.362	0.99
112_G	133_T	3.341	0.99
47_G	95_N	2.953	0.98
149_G	152_G	2.889	0.97
115_A	126_W	2.659	0.96
88_L	103_A	2.610	0.95
108_F	158_V	2.225	0.89
20_F	23_F	2.114	0.87
20_F	24_F	2.094	0.86
19_Q	23_F	2.051	0.85
39_N	43_D	1.929	0.81
126_W	164_W	1.883	0.79
70_L	128_I	1.877	0.79
24_F	159_Y	1.854	0.78
80_F	84_L	1.843	0.78
58_V	62_I	1.813	0.77
66_I	134_L	1.755	0.74
42_S	100_H	1.739	0.73
25_I	30_L	1.736	0.73
59_I	163_I	1.589	0.66
125_F	129_L	1.588	0.66
58_V	90_G	1.549	0.64
67_A	78_L	1.524	0.63
69_I	106_I	1.480	0.61
136_S	157_I	1.467	0.60
89_V	154_E	1.461	0.60
68_S	80_F	1.430	0.58
59_I	169_A	1.421	0.57
140_F	149_G	1.418	0.57
108_F	160_P	1.413	0.57
95_N	140_F	1.406	0.57
53_F	103_A	1.403	0.56
57_I	115_A	1.373	0.55
53_F	86_A	1.364	0.54
24_F	36_V	1.363	0.54
52_I	56_S	1.349	0.53
29_I	33_N	1.336	0.53
12_L	132_A	1.335	0.53
16_G	73_A	1.333	0.52
115_A	162_I	1.311	0.51
108_F	157_I	1.310	0.51
61_G	90_G	1.310	0.51
13_I	67_A	1.306	0.51
30_L	33_N	1.261	0.48
92_F	116_L	1.256	0.48
11_Y	80_F	1.249	0.48
27_S	102_I	1.248	0.48
156_M	167_S	1.246	0.48
33_N	67_A	1.244	0.47
132_A	135_V	1.225	0.46
73_A	116_L	1.221	0.46
70_L	92_F	1.212	0.46
41_I	108_F	1.207	0.45
39_N	56_S	1.190	0.44
84_L	138_I	1.187	0.44
104_S	112_G	1.176	0.44
111_G	161_E	1.169	0.43
13_I	64_V	1.158	0.43
9_S	170_T	1.149	0.42
103_A	106_I	1.148	0.42
66_I	131_I	1.148	0.42
67_A	93_P	1.137	0.41
21_L	79_V	1.131	0.41
152_G	172_L	1.124	0.41
60_M	165_G	1.093	0.39
9_S	13_I	1.092	0.39
65_I	84_L	1.085	0.39
85_G	106_I	1.081	0.38
102_I	141_I	1.048	0.37
59_I	65_I	1.045	0.36
46_V	131_I	1.043	0.36
81_L	84_L	1.019	0.35
42_S	104_S	1.012	0.35
35_S	166_I	1.009	0.35
66_I	72_R	1.007	0.35
59_I	166_I	1.004	0.34
9_S	115_A	1.002	0.34
74_N	128_I	0.997	0.34
94_E	125_F	0.981	0.33
53_F	88_L	0.978	0.33
24_F	34_Y	0.971	0.33
85_G	103_A	0.963	0.32
65_I	106_I	0.959	0.32
116_L	131_I	0.955	0.32
77_P	122_R	0.949	0.32
93_P	160_P	0.948	0.32
90_G	105_L	0.945	0.31
84_L	91_I	0.945	0.31
81_L	135_V	0.936	0.31
83_G	91_I	0.928	0.31
69_I	157_I	0.921	0.30
157_I	160_P	0.919	0.30
41_I	125_F	0.915	0.30
40_Y	43_D	0.906	0.30
17_V	148_L	0.899	0.29
58_V	166_I	0.897	0.29
85_G	104_S	0.895	0.29
16_G	139_L	0.893	0.29
85_G	111_G	0.889	0.29
10_G	17_V	0.888	0.29
71_L	92_F	0.887	0.29
109_L	121_K	0.882	0.28
36_V	53_F	0.873	0.28
26_I	160_P	0.870	0.28
76_S	127_G	0.860	0.27
115_A	170_T	0.859	0.27
25_I	136_S	0.858	0.27
32_P	172_L	0.855	0.27
18_S	169_A	0.847	0.27
24_F	103_A	0.846	0.27
88_L	170_T	0.845	0.27
11_Y	125_F	0.836	0.26
74_N	87_A	0.830	0.26
8_V	21_L	0.827	0.26
112_G	158_V	0.825	0.26
62_I	131_I	0.819	0.26
20_F	140_F	0.805	0.25
108_F	154_E	0.804	0.25
12_L	21_L	0.795	0.25
148_L	152_G	0.794	0.25
62_I	145_Y	0.792	0.24
15_V	92_F	0.792	0.24
77_P	138_I	0.785	0.24
26_I	90_G	0.780	0.24
28_E	36_V	0.780	0.24
117_V	167_S	0.780	0.24
56_S	94_E	0.776	0.24
79_V	114_G	0.774	0.24
12_L	33_N	0.771	0.24
58_V	110_F	0.764	0.23
85_G	89_V	0.764	0.23
28_E	31_Y	0.763	0.23
128_I	132_A	0.760	0.23
102_I	125_F	0.759	0.23
9_S	24_F	0.756	0.23
39_N	63_L	0.755	0.23
130_G	134_L	0.747	0.23
113_I	132_A	0.737	0.22
135_V	163_I	0.731	0.22
112_G	130_G	0.726	0.22
128_I	161_E	0.725	0.22
99_P	135_V	0.719	0.22
56_S	164_W	0.716	0.21
36_V	159_Y	0.714	0.21
44_L	155_R	0.712	0.21
89_V	104_S	0.712	0.21
12_L	125_F	0.707	0.21
59_I	142_L	0.707	0.21
26_I	30_L	0.705	0.21
85_G	158_V	0.704	0.21
64_V	165_G	0.701	0.21
61_G	83_G	0.696	0.21
90_G	97_G	0.695	0.21
60_M	160_P	0.694	0.21
56_S	110_F	0.691	0.21
94_E	157_I	0.688	0.20
40_Y	158_V	0.686	0.20
120_I	170_T	0.684	0.20
42_S	154_E	0.684	0.20
84_L	116_L	0.682	0.20
66_I	82_V	0.682	0.20
118_T	129_L	0.682	0.20
59_I	78_L	0.678	0.20
86_A	108_F	0.677	0.20
40_Y	94_E	0.674	0.20
48_K	67_A	0.671	0.20
13_I	71_L	0.668	0.20
113_I	117_V	0.666	0.20
94_E	115_A	0.661	0.19
87_A	119_S	0.660	0.19
62_I	99_P	0.653	0.19
137_L	153_L	0.642	0.19
89_V	129_L	0.642	0.19
91_I	146_G	0.639	0.19
119_S	127_G	0.635	0.19
43_D	83_G	0.634	0.18
129_L	163_I	0.631	0.18
76_S	116_L	0.630	0.18
13_I	19_Q	0.626	0.18
10_G	92_F	0.625	0.18
133_T	169_A	0.625	0.18
86_A	158_V	0.625	0.18
18_S	79_V	0.622	0.18
108_F	112_G	0.621	0.18
33_N	172_L	0.620	0.18
62_I	117_V	0.616	0.18
111_G	169_A	0.615	0.18
15_V	131_I	0.615	0.18
130_G	154_E	0.614	0.18
24_F	53_F	0.613	0.18
134_L	163_I	0.613	0.18
106_I	172_L	0.612	0.18
47_G	67_A	0.608	0.18
8_V	122_R	0.607	0.18
163_I	167_S	0.604	0.17
73_A	80_F	0.602	0.17
97_G	169_A	0.599	0.17
9_S	12_L	0.599	0.17
85_G	159_Y	0.598	0.17
22_L	70_L	0.598	0.17
78_L	109_L	0.591	0.17
47_G	108_F	0.591	0.17
10_G	112_G	0.585	0.17
83_G	167_S	0.585	0.17
24_F	57_I	0.580	0.17
113_I	135_V	0.578	0.17
66_I	73_A	0.577	0.17
29_I	112_G	0.572	0.16
113_I	152_G	0.565	0.16
101_L	169_A	0.560	0.16
139_L	143_K	0.559	0.16
111_G	158_V	0.556	0.16
20_F	86_A	0.555	0.16
17_V	20_F	0.554	0.16
36_V	133_T	0.553	0.16
46_V	122_R	0.552	0.16
28_E	133_T	0.552	0.16
13_I	164_W	0.551	0.16
89_V	94_E	0.548	0.16
104_S	107_T	0.546	0.16
145_Y	153_L	0.546	0.16
88_L	99_P	0.545	0.16
29_I	138_I	0.543	0.16
40_Y	103_A	0.543	0.16
46_V	95_N	0.540	0.15
54_N	95_N	0.536	0.15
117_V	127_G	0.536	0.15
25_I	105_L	0.535	0.15
80_F	139_L	0.533	0.15
100_H	155_R	0.532	0.15
35_S	162_I	0.524	0.15
61_G	155_R	0.524	0.15
40_Y	108_F	0.523	0.15
38_Y	138_I	0.523	0.15
20_F	88_L	0.518	0.15
64_V	149_G	0.515	0.15
61_G	91_I	0.509	0.15
39_N	118_T	0.507	0.15
113_I	170_T	0.505	0.14
102_I	161_E	0.505	0.14
58_V	127_G	0.504	0.14
22_L	83_G	0.503	0.14
131_I	137_L	0.503	0.14
77_P	81_L	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1pe9A	1	0.3333	1.3	0.967	Contact Map
4kppA	1	0.3736	1.3	0.967	Contact Map
2v2fA	1	0.0862	1	0.969	Contact Map
1pclA	1	0.3276	1	0.969	Contact Map
1gff3	1	0.069	0.9	0.97	Contact Map
3x29A	1	0.3736	0.8	0.97	Contact Map
3oufA	4	0.5172	0.8	0.971	Contact Map
4pypA	1	0.9368	0.7	0.972	Contact Map
1jb0M	1	0.1782	0.7	0.972	Contact Map
2ww8A	1	0.2241	0.7	0.973	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.