Q97U86 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97U86 - Regulatory protein, putative

UniProt:	Q97U86	Sequences: MSQEESGPFFEDFKVGQKFKSKVGRTITDVDNIWFTLLTNNSNQIHFNKDYTEKYFPGEPFNGRLVVNGFLTLTIVAGLLVEQTSQNGFMLGIENVKFLHPVFSGDTIYAEAEVIKVRESKSRPGFGIVKIRSYGYNQKGEKLIEFDRVFMVRKRGAKWSS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	161 (134)
Sequences:	6691 (4276)
Seq/√Len:	369.4

ECOLI - PAAZ
BACSU - YDEM
HALSA - Q9HN18 Q9HRM9
SULSO - Q97U86 Q97YZ5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
18_K	111_E	2.811	1.00
64_R	103_F	2.781	1.00
10_F	117_V	2.741	1.00
115_I	132_R	2.612	1.00
116_K	130_K	2.571	1.00
26_T	107_T	2.322	1.00
95_N	147_D	2.303	1.00
18_K	113_E	2.295	1.00
14_K	17_Q	2.229	1.00
113_E	132_R	2.164	1.00
100_H	141_E	2.134	1.00
32_N	104_S	2.001	1.00
25_R	31_D	1.869	1.00
113_E	134_Y	1.797	1.00
49_K	53_E	1.761	1.00
29_D	49_K	1.746	1.00
132_R	147_D	1.714	1.00
76_V	135_G	1.696	1.00
50_D	53_E	1.687	1.00
72_T	102_V	1.683	1.00
136_Y	142_K	1.677	1.00
111_E	134_Y	1.664	1.00
20_K	111_E	1.659	1.00
15_V	116_K	1.626	1.00
37_L	42_S	1.598	1.00
118_R	128_I	1.587	1.00
49_K	65_L	1.587	1.00
134_Y	142_K	1.557	1.00
29_D	65_L	1.539	1.00
28_T	31_D	1.532	1.00
111_E	136_Y	1.529	1.00
102_V	143_L	1.509	1.00
27_I	75_I	1.478	1.00
73_L	96_V	1.430	1.00
49_K	64_R	1.403	1.00
107_T	137_N	1.389	1.00
33_I	37_L	1.374	1.00
115_I	147_D	1.369	1.00
106_D	138_Q	1.344	1.00
130_K	147_D	1.322	1.00
86_Q	89_F	1.311	1.00
94_E	130_K	1.285	1.00
117_V	129_V	1.277	1.00
14_K	117_V	1.277	1.00
15_V	117_V	1.255	1.00
137_N	141_E	1.247	1.00
112_A	131_I	1.243	1.00
132_R	145_E	1.236	1.00
97_K	145_E	1.207	1.00
71_L	75_I	1.196	1.00
24_G	107_T	1.193	1.00
24_G	109_Y	1.192	1.00
79_L	110_A	1.190	1.00
29_D	33_I	1.179	1.00
60_P	63_G	1.174	1.00
130_K	149_V	1.164	1.00
135_G	144_I	1.150	1.00
44_Q	51_Y	1.142	1.00
46_H	69_G	1.129	1.00
36_T	68_N	1.128	1.00
27_I	71_L	1.122	1.00
94_E	147_D	1.122	1.00
110_A	133_S	1.121	1.00
50_D	54_K	1.108	1.00
54_K	59_E	1.103	1.00
36_T	47_F	1.064	1.00
99_L	145_E	1.063	1.00
30_V	34_W	1.058	1.00
23_V	82_E	1.057	1.00
72_T	144_I	1.052	1.00
128_I	149_V	1.046	1.00
131_I	150_F	1.038	1.00
30_V	33_I	1.022	1.00
106_D	137_N	1.013	1.00
103_F	106_D	1.011	1.00
76_V	110_A	1.009	1.00
34_W	37_L	1.003	1.00
115_I	130_K	0.993	1.00
34_W	38_L	0.987	1.00
102_V	108_I	0.976	1.00
32_N	67_V	0.972	1.00
85_S	89_F	0.956	1.00
72_T	135_G	0.954	1.00
110_A	135_G	0.942	1.00
114_V	131_I	0.912	1.00
96_V	146_F	0.902	1.00
30_V	37_L	0.898	1.00
16_G	113_E	0.895	1.00
93_I	96_V	0.889	1.00
78_G	82_E	0.877	1.00
118_R	130_K	0.869	1.00
114_V	129_V	0.867	1.00
106_D	139_K	0.865	1.00
136_Y	143_L	0.856	1.00
70_F	77_A	0.852	1.00
120_S	128_I	0.851	1.00
39_T	68_N	0.850	1.00
48_N	51_Y	0.849	1.00
51_Y	59_E	0.848	1.00
109_Y	136_Y	0.846	1.00
42_S	47_F	0.835	1.00
109_Y	140_G	0.818	1.00
20_K	109_Y	0.816	1.00
83_Q	112_A	0.808	1.00
70_F	73_L	0.797	1.00
13_F	129_V	0.782	1.00
112_A	133_S	0.777	1.00
64_R	104_S	0.777	1.00
66_V	103_F	0.774	1.00
39_T	71_L	0.773	1.00
10_F	127_G	0.773	1.00
120_S	151_M	0.772	1.00
93_I	148_R	0.769	1.00
33_I	47_F	0.763	1.00
126_F	151_M	0.761	1.00
103_F	139_K	0.760	1.00
26_T	105_G	0.756	1.00
41_N	68_N	0.755	1.00
76_V	133_S	0.754	1.00
31_D	34_W	0.747	1.00
10_F	119_E	0.746	1.00
137_N	143_L	0.742	1.00
44_Q	59_E	0.735	1.00
65_L	104_S	0.729	1.00
46_H	68_N	0.729	1.00
70_F	93_I	0.718	1.00
68_N	71_L	0.718	1.00
70_F	98_F	0.706	0.99
80_L	148_R	0.703	0.99
77_A	81_V	0.701	0.99
53_E	63_G	0.701	0.99
120_S	126_F	0.699	0.99
134_Y	145_E	0.698	0.99
99_L	144_I	0.696	0.99
76_V	146_F	0.690	0.99
91_L	151_M	0.689	0.99
25_R	75_I	0.675	0.99
94_E	97_K	0.673	0.99
17_Q	117_V	0.668	0.99
51_Y	54_K	0.661	0.99
76_V	144_I	0.658	0.99
99_L	142_K	0.658	0.99
142_K	145_E	0.655	0.99
44_Q	48_N	0.645	0.99
100_H	137_N	0.644	0.99
136_Y	140_G	0.643	0.99
13_F	114_V	0.643	0.99
13_F	17_Q	0.636	0.99
77_A	93_I	0.636	0.99
80_L	131_I	0.630	0.99
85_S	88_G	0.628	0.99
92_G	149_V	0.624	0.99
25_R	71_L	0.624	0.99
36_T	41_N	0.624	0.99
61_F	101_P	0.622	0.99
128_I	151_M	0.621	0.99
133_S	148_R	0.619	0.99
43_N	51_Y	0.618	0.99
93_I	149_V	0.615	0.99
108_I	135_G	0.611	0.98
59_E	63_G	0.607	0.98
121_K	126_F	0.604	0.98
63_G	103_F	0.604	0.98
70_F	74_T	0.603	0.98
66_V	101_P	0.598	0.98
60_P	66_V	0.596	0.98
84_T	87_N	0.595	0.98
100_H	143_L	0.593	0.98
70_F	148_R	0.583	0.98
73_L	98_F	0.582	0.98
31_D	40_N	0.579	0.98
80_L	133_S	0.576	0.98
80_L	150_F	0.572	0.98
40_N	78_G	0.566	0.97
91_L	128_I	0.564	0.97
73_L	144_I	0.563	0.97
41_N	46_H	0.561	0.97
107_T	138_Q	0.559	0.97
94_E	149_V	0.557	0.97
136_Y	139_K	0.556	0.97
53_E	64_R	0.555	0.97
80_L	112_A	0.550	0.97
26_T	31_D	0.550	0.97
137_N	140_G	0.547	0.97
27_I	102_V	0.541	0.97
84_T	88_G	0.539	0.97
53_E	60_P	0.537	0.97
84_T	89_F	0.535	0.96
28_T	33_I	0.534	0.96
73_L	77_A	0.531	0.96
31_D	71_L	0.530	0.96
23_V	79_L	0.530	0.96
39_T	46_H	0.526	0.96
100_H	139_K	0.522	0.96
36_T	42_S	0.522	0.96
73_L	93_I	0.520	0.96
114_V	117_V	0.514	0.96
117_V	127_G	0.511	0.95
13_F	117_V	0.503	0.95
133_S	146_F	0.502	0.95
118_R	121_K	0.500	0.95

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4e3eA	3	0.9379	100	0.238	Contact Map
1q6wA	6	0.8882	100	0.251	Contact Map
4ffuA	6	0.9503	100	0.252	Contact Map
2bi0A	3	0.9565	100	0.254	Contact Map
3exzA	2	0.9006	100	0.258	Contact Map
3ir3A	2	0.7888	100	0.3	Contact Map
4rv2B	2	0.8447	100	0.31	Contact Map
4v12A	2	0.8758	100	0.316	Contact Map
2c2iA	2	0.882	100	0.324	Contact Map
1iq6A	2	0.8261	100	0.331	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.