Q97U66 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97U66 - Tryptophan repressor binding protein (WrbA)

UniProt:	Q97U66	Sequences: MECPKILVLFYGYGSIVDLAKNVAEGAKEITKEVKLARVKEYFPQEIVNKFRIPIDTVKDIPEATLSDLEWADGIVMGSPTRYGNMTGQLKLFLDQTAELWIKGSLYGKPVGFFTEASTMHGGHESTILAMANYAYHHGMIIVPVGYGIKEVSSTMTGGSPYGASHLGNKKELDENEINIAKFLGKRVAEVAKKLRC	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	197 (187)
Sequences:	2802 (1605)
Seq/√Len:	117.3

ECOLI - NQOR
BACSU - YHCB
SULSO - Q97U66

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
186_K	190_E	3.183	1.00
76_V	188_V	2.910	1.00
29_E	186_K	2.892	1.00
112_G	184_L	2.694	1.00
19_L	181_A	2.630	1.00
126_S	129_L	2.468	1.00
11_Y	87_T	2.433	1.00
24_A	28_K	2.389	1.00
175_E	179_N	2.141	1.00
25_E	182_K	2.109	1.00
27_A	34_V	2.089	1.00
5_K	33_E	2.080	1.00
17_V	21_K	2.078	1.00
79_S	87_T	2.011	1.00
97_T	138_H	2.010	1.00
185_G	189_A	1.974	1.00
110_P	195_L	1.970	1.00
76_V	112_G	1.930	1.00
115_T	165_S	1.917	1.00
112_G	188_V	1.911	1.00
29_E	182_K	1.884	1.00
111_V	135_A	1.837	1.00
107_Y	148_G	1.797	1.00
6_I	74_G	1.779	1.00
22_N	182_K	1.777	1.00
113_F	131_M	1.753	1.00
100_L	105_S	1.746	1.00
91_K	134_Y	1.729	1.00
22_N	25_E	1.727	1.00
35_K	68_D	1.717	1.00
67_S	70_E	1.713	1.00
70_E	100_L	1.677	1.00
160_S	165_S	1.661	1.00
91_K	95_D	1.646	1.00
143_V	191_V	1.640	1.00
145_V	180_I	1.625	1.00
26_G	185_G	1.618	1.00
42_Y	92_L	1.607	1.00
22_N	178_I	1.591	1.00
70_E	105_S	1.590	1.00
164_A	184_L	1.562	1.00
136_Y	144_P	1.534	1.00
39_V	90_L	1.516	1.00
78_G	114_F	1.515	1.00
23_V	114_F	1.469	1.00
77_M	131_M	1.451	1.00
18_D	21_K	1.423	1.00
85_N	130_A	1.421	1.00
7_L	72_A	1.406	1.00
25_E	28_K	1.391	1.00
19_L	164_A	1.345	1.00
79_S	131_M	1.333	1.00
117_A	124_H	1.327	1.00
17_V	61_I	1.320	1.00
108_G	190_E	1.307	1.00
35_K	72_A	1.300	1.00
32_K	193_K	1.293	1.00
108_G	187_R	1.289	1.00
115_T	128_I	1.255	0.99
190_E	194_K	1.240	0.99
10_F	61_I	1.227	0.99
48_V	53_I	1.225	0.99
18_D	178_I	1.224	0.99
104_G	107_Y	1.222	0.99
110_P	188_V	1.212	0.99
8_V	24_A	1.210	0.99
6_I	27_A	1.203	0.99
67_S	71_W	1.201	0.99
132_A	136_Y	1.197	0.99
8_V	27_A	1.192	0.99
111_V	140_M	1.190	0.99
181_A	185_G	1.177	0.99
136_Y	142_I	1.165	0.99
7_L	37_A	1.150	0.99
151_E	179_N	1.147	0.99
74_G	188_V	1.140	0.99
157_T	174_D	1.113	0.99
30_I	193_K	1.109	0.99
157_T	176_N	1.105	0.99
89_Q	95_D	1.103	0.99
75_I	140_M	1.091	0.98
64_A	68_D	1.091	0.98
48_V	55_I	1.089	0.98
86_M	91_K	1.087	0.98
28_K	34_V	1.080	0.98
116_E	168_G	1.069	0.98
86_M	131_M	1.044	0.98
173_L	178_I	1.042	0.98
32_K	189_A	1.039	0.98
48_V	51_F	1.034	0.98
43_F	51_F	1.030	0.98
47_I	50_K	1.028	0.98
25_E	29_E	1.028	0.98
37_A	68_D	1.021	0.98
5_K	71_W	1.020	0.98
110_P	192_A	1.020	0.98
21_K	28_K	1.007	0.97
69_L	97_T	1.000	0.97
100_L	106_L	0.999	0.97
113_F	132_A	0.993	0.97
141_I	191_V	0.992	0.97
26_G	189_A	0.991	0.97
85_N	134_Y	0.990	0.97
113_F	128_I	0.979	0.97
43_F	48_V	0.974	0.97
191_V	195_L	0.973	0.97
174_D	177_E	0.971	0.97
31_T	193_K	0.970	0.97
66_L	96_Q	0.962	0.96
88_G	92_L	0.960	0.96
178_I	182_K	0.948	0.96
68_D	71_W	0.945	0.96
70_E	103_K	0.940	0.96
21_K	36_L	0.934	0.96
85_N	91_K	0.930	0.96
79_S	86_M	0.929	0.96
30_I	189_A	0.927	0.96
52_R	56_D	0.915	0.95
149_I	180_I	0.914	0.95
94_L	134_Y	0.910	0.95
65_T	68_D	0.905	0.95
90_L	94_L	0.905	0.95
47_I	51_F	0.904	0.95
74_G	110_P	0.904	0.95
86_M	130_A	0.902	0.95
117_A	167_L	0.901	0.95
4_P	32_K	0.898	0.95
184_L	188_V	0.897	0.95
112_G	164_A	0.897	0.95
5_K	73_D	0.894	0.95
19_L	166_H	0.893	0.95
10_F	17_V	0.887	0.94
16_I	78_G	0.883	0.94
5_K	35_K	0.878	0.94
27_A	32_K	0.876	0.94
26_G	181_A	0.874	0.94
30_I	190_E	0.872	0.94
51_F	54_P	0.863	0.94
175_E	178_I	0.860	0.93
35_K	71_W	0.860	0.93
36_L	61_I	0.858	0.93
27_A	189_A	0.854	0.93
6_I	189_A	0.853	0.93
18_D	172_E	0.851	0.93
4_P	192_A	0.851	0.93
6_I	32_K	0.844	0.93
150_K	153_S	0.842	0.93
110_P	191_V	0.839	0.93
86_M	134_Y	0.826	0.92
183_F	187_R	0.826	0.92
77_M	94_L	0.824	0.92
23_V	185_G	0.822	0.92
154_S	176_N	0.820	0.92
28_K	33_E	0.814	0.91
21_K	61_I	0.804	0.91
129_L	162_Y	0.800	0.91
129_L	133_N	0.798	0.91
81_T	117_A	0.788	0.90
135_A	140_M	0.781	0.90
113_F	135_A	0.781	0.90
113_F	142_I	0.779	0.90
148_G	183_F	0.778	0.90
17_V	38_R	0.775	0.89
16_I	114_F	0.774	0.89
66_L	97_T	0.769	0.89
20_A	114_F	0.769	0.89
40_K	63_E	0.768	0.89
23_V	26_G	0.768	0.89
81_T	127_T	0.767	0.89
149_I	183_F	0.761	0.88
23_V	184_L	0.758	0.88
130_A	133_N	0.757	0.88
48_V	56_D	0.756	0.88
23_V	181_A	0.745	0.87
166_H	173_L	0.740	0.87
21_K	60_D	0.740	0.87
24_A	36_L	0.736	0.87
88_G	95_D	0.723	0.86
21_K	24_A	0.720	0.86
179_N	182_K	0.719	0.85
143_V	188_V	0.718	0.85
49_N	52_R	0.714	0.85
126_S	130_A	0.712	0.85
182_K	186_K	0.703	0.84
66_L	100_L	0.699	0.84
49_N	55_I	0.696	0.84
125_E	133_N	0.695	0.84
128_I	131_M	0.688	0.83
74_G	192_A	0.684	0.83
118_S	169_N	0.683	0.82
43_F	92_L	0.679	0.82
66_L	70_E	0.678	0.82
77_M	90_L	0.675	0.82
110_P	141_I	0.674	0.82
32_K	73_D	0.668	0.81
22_N	26_G	0.668	0.81
149_I	152_V	0.665	0.81
136_Y	146_G	0.664	0.81
28_K	31_T	0.660	0.80
121_H	125_E	0.659	0.80
146_G	187_R	0.656	0.80
37_A	72_A	0.656	0.80
157_T	165_S	0.653	0.80
24_A	34_V	0.649	0.79
51_F	55_I	0.648	0.79
39_V	42_Y	0.648	0.79
125_E	129_L	0.647	0.79
86_M	90_L	0.645	0.79
121_H	162_Y	0.641	0.78
187_R	191_V	0.641	0.78
71_W	175_E	0.641	0.78
21_K	25_E	0.640	0.78
141_I	194_K	0.638	0.78
53_I	56_D	0.636	0.78
42_Y	88_G	0.633	0.77
179_N	183_F	0.633	0.77
55_I	59_K	0.628	0.77
151_E	180_I	0.619	0.76
171_K	174_D	0.619	0.76
23_V	76_V	0.617	0.76
43_F	53_I	0.615	0.75
93_F	97_T	0.613	0.75
155_T	176_N	0.612	0.75
69_L	106_L	0.612	0.75
5_K	64_A	0.612	0.75
80_P	127_T	0.606	0.74
132_A	142_I	0.602	0.74
56_D	59_K	0.601	0.74
17_V	54_P	0.599	0.73
97_T	100_L	0.589	0.72
52_R	55_I	0.588	0.72
79_S	115_T	0.585	0.72
79_S	85_N	0.584	0.72
149_I	187_R	0.582	0.71
145_V	164_A	0.581	0.71
27_A	192_A	0.577	0.71
51_F	56_D	0.575	0.70
8_V	20_A	0.570	0.70
152_V	180_I	0.569	0.70
10_F	59_K	0.569	0.70
137_H	162_Y	0.568	0.70
99_E	102_I	0.568	0.70
6_I	192_A	0.567	0.69
141_I	144_P	0.566	0.69
43_F	96_Q	0.562	0.69
104_G	139_G	0.562	0.69
69_L	93_F	0.560	0.68
75_I	111_V	0.559	0.68
5_K	32_K	0.559	0.68
38_R	41_E	0.559	0.68
175_E	182_K	0.556	0.68
120_M	167_L	0.552	0.67
92_L	96_Q	0.551	0.67
75_I	110_P	0.550	0.67
155_T	158_G	0.550	0.67
69_L	75_I	0.550	0.67
23_V	164_A	0.546	0.66
104_G	148_G	0.540	0.66
16_I	79_S	0.539	0.66
101_W	139_G	0.531	0.64
147_Y	161_P	0.527	0.64
171_K	177_E	0.526	0.64
146_G	183_F	0.522	0.63
94_L	97_T	0.521	0.63
121_H	157_T	0.518	0.62
90_L	131_M	0.517	0.62
82_R	117_A	0.516	0.62
91_K	131_M	0.513	0.62
79_S	113_F	0.513	0.62
7_L	64_A	0.511	0.61
124_H	167_L	0.511	0.61
94_L	130_A	0.511	0.61
22_N	173_L	0.511	0.61
120_M	174_D	0.511	0.61
9_L	37_A	0.508	0.61
129_L	132_A	0.505	0.61
121_H	165_S	0.504	0.60
48_V	61_I	0.504	0.60
49_N	56_D	0.503	0.60
141_I	195_L	0.500	0.60

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2zkiA	7	0.9898	100	0.47	Contact Map
1ydgA	4	0.9848	100	0.494	Contact Map
2a5lA	4	0.868	100	0.498	Contact Map
4lafA	4	0.9949	100	0.5	Contact Map
3d7nA	4	0.7817	100	0.513	Contact Map
3zhoA	4	0.9543	100	0.515	Contact Map
2arkA	4	0.8274	100	0.588	Contact Map
2fzvA	5	0.9086	99.9	0.618	Contact Map
2q62A	4	0.9036	99.9	0.619	Contact Map
1sqsA	2	0.8731	99.9	0.623	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.