Q97U56 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97U56 - MutT-like protein

UniProt:	Q97U56	Sequences: MNISKLLQLPLTDDNESDAAVVVLIAKGQYILLIKRVSNPKDPWSGQMALPGGHRENNETAFQAAIRECEEEVGIRPNIRSSLGVFSPNNIKIKVRAYIALLDELIEPRPNPVEVDKVFWVHESELVRGDNAFYYKQYRIWGMTYRILSKLFEIAELKI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	159 (140)
Sequences:	3062 (2205)
Seq/√Len:	186.4

ECOLI - NUDL
HALSA - Q9HSE2
SULSO - Q97U56

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
55_R	64_A	4.853	1.00
33_L	148_L	3.437	1.00
62_F	98_Y	2.813	1.00
22_V	69_C	2.482	1.00
59_E	63_Q	2.479	1.00
80_R	100_A	2.473	1.00
70_E	77_P	2.409	1.00
34_I	49_A	2.222	1.00
55_R	61_A	2.216	1.00
60_T	63_Q	2.188	1.00
117_K	138_Y	2.160	1.00
30_Y	120_W	2.155	1.00
110_P	118_V	2.029	1.00
81_S	103_D	1.939	1.00
22_V	100_A	1.931	1.00
23_V	147_I	1.868	1.00
143_M	147_I	1.801	1.00
62_F	82_S	1.775	1.00
62_F	85_V	1.732	1.00
38_S	116_D	1.661	1.00
61_A	98_Y	1.647	1.00
23_V	151_L	1.643	1.00
35_K	38_S	1.624	1.00
69_C	75_I	1.610	1.00
95_V	143_M	1.596	1.00
31_I	148_L	1.594	1.00
69_C	80_R	1.577	1.00
149_S	153_E	1.568	1.00
63_Q	77_P	1.560	1.00
87_S	150_K	1.544	1.00
24_L	102_L	1.443	1.00
48_M	138_Y	1.425	1.00
56_E	111_N	1.408	1.00
44_W	47_Q	1.399	1.00
18_D	55_R	1.399	1.00
35_K	117_K	1.392	1.00
140_I	148_L	1.380	1.00
35_K	138_Y	1.365	1.00
28_G	120_W	1.359	1.00
33_L	144_T	1.356	1.00
76_R	79_I	1.353	1.00
61_A	64_A	1.348	1.00
58_N	63_Q	1.329	1.00
40_P	45_S	1.326	1.00
35_K	116_D	1.322	1.00
39_N	113_V	1.321	1.00
119_F	138_Y	1.304	1.00
32_L	73_V	1.302	1.00
48_M	119_F	1.293	1.00
54_H	93_I	1.290	1.00
74_G	110_P	1.289	1.00
26_A	120_W	1.272	1.00
82_S	100_A	1.250	1.00
132_A	139_R	1.244	1.00
127_V	152_F	1.239	1.00
85_V	98_Y	1.225	1.00
66_I	70_E	1.224	1.00
126_L	152_F	1.198	1.00
122_H	125_E	1.184	1.00
91_I	143_M	1.168	1.00
89_N	146_R	1.159	1.00
70_E	76_R	1.158	1.00
26_A	30_Y	1.145	1.00
88_P	96_R	1.142	1.00
18_D	94_K	1.124	1.00
34_I	40_P	1.111	1.00
17_S	54_H	1.096	1.00
125_E	131_N	1.094	1.00
128_R	131_N	1.092	1.00
34_I	44_W	1.060	1.00
34_I	115_V	1.057	1.00
135_Y	140_I	1.048	1.00
58_N	64_A	1.040	1.00
88_P	94_K	1.027	1.00
99_I	151_L	1.010	0.99
95_V	147_I	0.991	0.99
24_L	100_A	0.988	0.99
61_A	96_R	0.970	0.99
20_A	61_A	0.968	0.99
33_L	48_M	0.961	0.99
19_A	93_I	0.955	0.99
27_K	101_L	0.935	0.99
38_S	45_S	0.934	0.99
48_M	140_I	0.915	0.99
121_V	140_I	0.902	0.99
50_L	147_I	0.898	0.99
69_C	98_Y	0.882	0.99
79_I	103_D	0.876	0.99
37_V	40_P	0.876	0.99
93_I	143_M	0.872	0.99
108_P	118_V	0.868	0.98
16_E	90_N	0.853	0.98
17_S	93_I	0.849	0.98
90_N	94_K	0.845	0.98
134_Y	137_Q	0.840	0.98
125_E	136_K	0.831	0.98
146_R	150_K	0.831	0.98
103_D	106_I	0.827	0.98
82_S	98_Y	0.825	0.98
77_P	80_R	0.820	0.98
66_I	82_S	0.817	0.98
86_F	97_A	0.811	0.98
47_Q	93_I	0.797	0.97
33_L	50_L	0.792	0.97
21_V	147_I	0.784	0.97
23_V	31_I	0.781	0.97
32_L	102_L	0.781	0.97
22_V	82_S	0.780	0.97
34_I	43_P	0.777	0.97
40_P	44_W	0.759	0.96
28_G	105_L	0.758	0.96
33_L	152_F	0.756	0.96
25_I	123_E	0.750	0.96
70_E	109_R	0.749	0.96
37_V	45_S	0.749	0.96
124_S	128_R	0.744	0.96
81_S	101_L	0.734	0.96
125_E	135_Y	0.731	0.96
79_I	106_I	0.726	0.95
66_I	80_R	0.723	0.95
23_V	50_L	0.719	0.95
25_I	99_I	0.716	0.95
18_D	61_A	0.713	0.95
25_I	30_Y	0.707	0.95
22_V	65_A	0.705	0.95
18_D	88_P	0.702	0.95
38_S	46_G	0.701	0.94
125_E	140_I	0.699	0.94
60_T	64_A	0.695	0.94
126_L	148_L	0.695	0.94
135_Y	138_Y	0.694	0.94
123_E	127_V	0.690	0.94
85_V	96_R	0.690	0.94
73_V	115_V	0.687	0.94
86_F	99_I	0.683	0.94
28_G	104_E	0.678	0.93
69_C	73_V	0.676	0.93
134_Y	139_R	0.673	0.93
62_F	66_I	0.673	0.93
73_V	110_P	0.668	0.93
43_P	93_I	0.665	0.93
85_V	88_P	0.665	0.93
66_I	77_P	0.664	0.93
70_E	78_N	0.661	0.93
143_M	150_K	0.649	0.92
25_I	151_L	0.649	0.92
44_W	145_Y	0.647	0.92
40_P	43_P	0.639	0.91
132_A	135_Y	0.636	0.91
34_I	73_V	0.633	0.91
22_V	80_R	0.632	0.91
77_P	100_A	0.632	0.91
149_S	152_F	0.630	0.91
40_P	113_V	0.629	0.91
129_G	152_F	0.628	0.91
31_I	123_E	0.628	0.91
24_L	50_L	0.615	0.90
24_L	51_P	0.614	0.90
80_R	102_L	0.604	0.89
73_V	118_V	0.602	0.89
131_N	144_T	0.601	0.89
50_L	89_N	0.594	0.88
68_E	114_E	0.593	0.88
43_P	91_I	0.592	0.88
86_F	154_I	0.592	0.88
40_P	49_A	0.591	0.88
89_N	152_F	0.591	0.88
109_R	130_D	0.590	0.88
74_G	111_N	0.587	0.87
36_R	115_V	0.587	0.87
20_A	97_A	0.587	0.87
35_K	48_M	0.580	0.87
25_I	31_I	0.578	0.87
133_F	137_Q	0.576	0.86
65_A	69_C	0.572	0.86
48_M	135_Y	0.571	0.86
150_K	154_I	0.564	0.85
48_M	141_W	0.562	0.85
86_F	150_K	0.561	0.85
151_L	154_I	0.561	0.85
44_W	91_I	0.561	0.85
133_F	152_F	0.559	0.85
133_F	140_I	0.550	0.84
69_C	74_G	0.550	0.84
83_L	101_L	0.549	0.84
97_A	147_I	0.545	0.83
19_A	117_K	0.541	0.83
122_H	135_Y	0.540	0.83
66_I	100_A	0.539	0.83
45_S	150_K	0.538	0.83
33_L	119_F	0.536	0.82
89_N	150_K	0.534	0.82
16_E	117_K	0.534	0.82
15_N	29_Q	0.529	0.81
123_E	152_F	0.528	0.81
45_S	49_A	0.526	0.81
84_G	99_I	0.526	0.81
19_A	48_M	0.524	0.81
37_V	113_V	0.521	0.81
26_A	147_I	0.519	0.80
20_A	23_V	0.515	0.80
20_A	28_G	0.511	0.79
115_V	145_Y	0.509	0.79
24_L	33_L	0.508	0.79
78_N	107_E	0.506	0.79
74_G	86_F	0.505	0.78
34_I	37_V	0.503	0.78
14_D	29_Q	0.503	0.78
41_K	48_M	0.502	0.78
45_S	146_R	0.500	0.78

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1nqzA	1	0.8491	99.9	0.51	Contact Map
3h95A	2	0.8302	99.8	0.62	Contact Map
4c9xA	2	0.8176	99.7	0.635	Contact Map
1u20A	2	0.9748	99.7	0.638	Contact Map
3kvhA	2	0.9057	99.7	0.638	Contact Map
3qsjA	1	0.9057	99.7	0.641	Contact Map
2w4eA	2	0.8365	99.7	0.645	Contact Map
5bonA	4	0.8302	99.7	0.648	Contact Map
4nfwA	6	0.8239	99.7	0.65	Contact Map
2fkbA	1	0.9245	99.7	0.653	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0092 seconds.