Q97U53 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97U53 - Uncharacterized protein

UniProt:	Q97U53	Sequences: MNACFKYIGFIKRNDNSTSRNAIIEIHVNKEYEEGLKGLEEFSHIIVIYHLHLASFDGRLLREKKGVTVGIFATRSQFRPNPIGISVAELIEIKGNIVLAKGINAFNNTPVLDIKPLSAVSDKP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	124 (118)
Sequences:	1780 (1254)
Seq/√Len:	115.4

ECOLI - TSAA
HALSA - Y1115
SULSO - Q97U53

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
89_E	101_K	3.273	1.00
92_E	99_L	3.248	1.00
37_K	60_L	2.734	1.00
12_K	27_H	2.653	1.00
25_E	97_I	2.572	1.00
39_L	93_I	2.335	1.00
91_I	101_K	2.241	1.00
12_K	107_N	2.168	1.00
48_I	83_I	2.100	1.00
60_L	68_T	2.091	1.00
90_L	98_V	2.033	1.00
69_V	74_T	2.022	1.00
26_I	100_A	1.933	1.00
50_H	112_L	1.923	1.00
5_F	50_H	1.897	1.00
39_L	45_I	1.888	1.00
26_I	47_V	1.874	1.00
11_I	111_V	1.744	1.00
27_H	97_I	1.735	1.00
13_R	24_I	1.710	1.00
46_I	87_V	1.705	1.00
100_A	103_I	1.694	1.00
23_I	99_L	1.657	1.00
94_K	99_L	1.650	1.00
88_A	100_A	1.631	1.00
25_E	99_L	1.620	1.00
47_V	111_V	1.587	1.00
24_I	103_I	1.563	1.00
53_L	106_F	1.557	1.00
83_I	112_L	1.523	1.00
50_H	82_P	1.522	1.00
23_I	91_I	1.511	1.00
5_F	82_P	1.473	1.00
45_I	90_L	1.462	1.00
6_K	31_E	1.415	1.00
34_E	60_L	1.349	1.00
49_Y	84_G	1.328	1.00
51_L	84_G	1.292	1.00
39_L	90_L	1.280	0.99
33_E	96_N	1.274	0.99
12_K	25_E	1.261	0.99
15_D	18_T	1.252	0.99
10_F	29_N	1.245	0.99
7_Y	10_F	1.232	0.99
28_V	114_I	1.205	0.99
47_V	88_A	1.186	0.99
36_L	96_N	1.173	0.99
46_I	85_I	1.172	0.99
5_F	112_L	1.154	0.99
48_I	112_L	1.143	0.99
61_L	74_T	1.129	0.99
15_D	19_S	1.125	0.99
23_I	101_K	1.123	0.99
62_R	66_G	1.096	0.98
48_I	85_I	1.077	0.98
91_I	99_L	1.052	0.98
16_N	19_S	1.035	0.98
24_I	105_A	1.033	0.98
71_I	76_S	1.031	0.98
9_G	28_V	0.999	0.97
62_R	65_K	0.982	0.97
38_G	69_V	0.978	0.97
52_H	106_F	0.977	0.97
45_I	88_A	0.963	0.96
94_K	97_I	0.946	0.96
56_F	82_P	0.942	0.96
14_N	22_A	0.941	0.96
30_K	33_E	0.941	0.96
36_L	98_V	0.938	0.96
84_G	109_T	0.932	0.96
8_I	35_G	0.925	0.95
61_L	65_K	0.921	0.95
45_I	114_I	0.917	0.95
69_V	73_A	0.917	0.95
11_I	24_I	0.909	0.95
49_Y	105_A	0.904	0.95
49_Y	86_S	0.885	0.94
105_A	111_V	0.879	0.94
13_R	105_A	0.878	0.94
47_V	114_I	0.855	0.93
58_G	78_F	0.839	0.92
93_I	98_V	0.832	0.92
26_I	111_V	0.816	0.91
47_V	105_A	0.815	0.91
36_L	90_L	0.814	0.91
118_S	121_S	0.810	0.91
32_Y	72_F	0.797	0.90
13_R	103_I	0.794	0.90
16_N	20_R	0.784	0.89
9_G	29_N	0.772	0.89
34_E	37_K	0.765	0.88
89_E	102_G	0.764	0.88
44_H	89_E	0.762	0.88
90_L	93_I	0.760	0.88
54_A	57_D	0.759	0.88
15_D	20_R	0.752	0.87
98_V	114_I	0.749	0.87
55_S	59_R	0.740	0.87
100_A	111_V	0.737	0.86
33_E	95_G	0.732	0.86
42_F	90_L	0.728	0.86
13_R	107_N	0.723	0.85
22_A	102_G	0.716	0.85
44_H	87_V	0.713	0.85
44_H	117_L	0.707	0.84
29_N	32_Y	0.703	0.84
46_I	117_L	0.699	0.83
38_G	74_T	0.697	0.83
35_G	59_R	0.695	0.83
56_F	59_R	0.687	0.82
61_L	64_K	0.685	0.82
62_R	68_T	0.677	0.81
27_H	96_N	0.677	0.81
51_L	109_T	0.676	0.81
84_G	110_P	0.673	0.81
36_L	39_L	0.664	0.80
55_S	82_P	0.664	0.80
87_V	120_V	0.661	0.80
74_T	77_Q	0.651	0.79
50_H	55_S	0.649	0.79
45_I	100_A	0.649	0.79
39_L	98_V	0.643	0.78
54_A	82_P	0.642	0.78
11_I	26_I	0.634	0.77
23_I	89_E	0.623	0.76
28_V	111_V	0.620	0.75
16_N	77_Q	0.619	0.75
49_Y	87_V	0.611	0.74
86_S	109_T	0.611	0.74
35_G	71_I	0.609	0.74
26_I	98_V	0.607	0.74
5_F	83_I	0.607	0.74
52_H	110_P	0.601	0.73
95_G	99_L	0.599	0.73
17_S	20_R	0.599	0.73
11_I	100_A	0.598	0.73
71_I	74_T	0.593	0.72
28_V	96_N	0.592	0.72
38_G	62_R	0.585	0.71
24_I	88_A	0.583	0.71
35_G	72_F	0.581	0.71
18_T	22_A	0.581	0.71
86_S	93_I	0.579	0.70
61_L	76_S	0.577	0.70
27_H	95_G	0.576	0.70
12_K	108_N	0.576	0.70
23_I	100_A	0.575	0.70
10_F	27_H	0.572	0.69
59_R	78_F	0.564	0.68
7_Y	112_L	0.561	0.68
86_S	104_N	0.559	0.68
38_G	65_K	0.553	0.67
25_E	94_K	0.553	0.67
17_S	103_I	0.546	0.66
75_R	85_I	0.544	0.66
11_I	105_A	0.541	0.65
86_S	117_L	0.540	0.65
94_K	120_V	0.537	0.65
20_R	87_V	0.534	0.64
21_N	101_K	0.533	0.64
21_N	102_G	0.530	0.64
75_R	106_F	0.528	0.63
25_E	92_E	0.527	0.63
19_S	103_I	0.523	0.63
46_I	78_F	0.521	0.62
41_E	69_V	0.520	0.62
51_L	71_I	0.520	0.62
105_A	109_T	0.519	0.62
36_L	114_I	0.517	0.62
28_V	120_V	0.510	0.61
87_V	121_S	0.506	0.60
54_A	59_R	0.505	0.60
103_I	106_F	0.505	0.60
16_N	84_G	0.504	0.60
75_R	84_G	0.504	0.60
56_F	103_I	0.500	0.59
11_I	14_N	0.500	0.59

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1xqbA	2	0.8629	100	0.094	Contact Map
2nv4A	2	0.9839	100	0.098	Contact Map
3okxA	2	1	100	0.136	Contact Map
3ut1A	2	0.8145	16	0.944	Contact Map
3a2qA	2	0.7984	10.1	0.949	Contact Map
2r58A	1	0.7742	9.1	0.95	Contact Map
4c5eA	3	0.8629	8.1	0.951	Contact Map
1oz2A	1	0.7984	7.7	0.951	Contact Map
4d9iA	2	0.4435	6.1	0.954	Contact Map
3f70A	2	0.8871	6	0.954	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.