Q97U52 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97U52 - First ORF in transposon ISC1904

UniProt:	Q97U52	Sequences: MLRPKEACQRLGISYATLREYVKKGYIKPVILQSGKWRFREEDVERLMGIIRKRKVILYARVSSSTQKDELVNQVKYLEEQVKEYDLVITDIGSGLNMKRKGFLKLLRMILNNEVSRVVVAYPDRLVRFGFEILEETCKAHNCEIVVLNQEDKEEELVEDLMSVLVSFSGKLYGMRSHEYEKVKKCAEELKN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	192 (181)
Sequences:	478 (335)
Seq/√Len:	24.9

SULSO - Q97U52 Q97U67 Q97YH2 Q97XB5 Q97UQ9 Q97YU0 Q97YX0 Q97YI6 Q97XI0 Q97XQ1 Q97XZ4 Q97X40 Q97Z60 Q97X25 Q97WZ6 Q97Y49

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
60_A	78_L	4.188	1.00
56_V	117_R	4.183	1.00
82_V	119_V	3.536	1.00
117_R	144_E	3.419	1.00
7_A	11_L	2.873	1.00
110_I	138_C	2.620	0.99
103_F	126_L	2.555	0.99
91_D	102_G	2.540	0.99
58_L	148_L	2.465	0.99
17_T	21_Y	2.424	0.98
13_I	21_Y	2.415	0.98
5_K	9_Q	2.345	0.98
135_E	139_K	2.207	0.97
85_Y	146_V	2.200	0.97
106_L	115_V	2.192	0.97
16_A	19_R	2.170	0.97
111_L	141_H	2.073	0.96
75_V	88_V	2.002	0.95
22_V	37_W	1.961	0.94
58_L	78_L	1.931	0.94
18_L	39_F	1.929	0.94
98_M	132_E	1.901	0.93
55_K	109_M	1.818	0.92
77_Y	121_A	1.798	0.91
96_L	129_F	1.775	0.91
131_F	145_I	1.770	0.90
3_R	34_S	1.683	0.88
110_I	115_V	1.674	0.88
119_V	132_E	1.672	0.88
75_V	90_T	1.666	0.88
89_I	102_G	1.621	0.86
127_V	131_F	1.615	0.86
16_A	24_K	1.599	0.85
110_I	118_V	1.587	0.85
27_I	30_V	1.576	0.84
109_M	114_E	1.564	0.84
4_P	19_R	1.555	0.84
58_L	88_V	1.531	0.83
131_F	147_V	1.523	0.82
166_V	177_S	1.520	0.82
138_C	143_C	1.519	0.82
98_M	167_S	1.471	0.80
40_R	43_D	1.436	0.78
26_Y	33_Q	1.431	0.78
12_G	142_N	1.417	0.77
72_V	76_K	1.387	0.76
70_E	73_N	1.370	0.75
17_T	20_E	1.360	0.74
22_V	29_P	1.338	0.73
167_S	170_G	1.332	0.73
96_L	130_G	1.320	0.72
155_E	159_E	1.318	0.72
14_S	20_E	1.316	0.72
119_V	146_V	1.315	0.72
31_I	37_W	1.300	0.71
89_I	118_V	1.293	0.70
122_Y	159_E	1.291	0.70
56_V	144_E	1.290	0.70
7_A	27_I	1.265	0.69
22_V	27_I	1.256	0.68
4_P	18_L	1.245	0.67
7_A	44_V	1.245	0.67
20_E	23_K	1.242	0.67
8_C	15_Y	1.233	0.67
64_S	67_Q	1.233	0.67
166_V	170_G	1.199	0.64
138_C	172_L	1.189	0.64
62_V	67_Q	1.187	0.64
8_C	13_I	1.187	0.64
15_Y	19_R	1.184	0.63
121_A	178_H	1.174	0.63
22_V	39_F	1.139	0.60
107_L	111_L	1.137	0.60
131_F	134_L	1.122	0.59
170_G	175_M	1.108	0.58
110_I	120_V	1.099	0.58
78_L	148_L	1.083	0.56
4_P	29_P	1.080	0.56
67_Q	70_E	1.078	0.56
58_L	82_V	1.071	0.56
164_V	174_G	1.062	0.55
91_D	167_S	1.060	0.55
91_D	121_A	1.051	0.54
3_R	38_R	1.049	0.54
62_V	71_L	1.036	0.53
57_I	75_V	1.030	0.53
159_E	170_G	1.011	0.51
117_R	146_V	1.009	0.51
11_L	18_L	1.009	0.51
89_I	106_L	1.005	0.51
56_V	93_G	1.004	0.51
57_I	89_I	1.000	0.51
173_Y	176_R	0.986	0.49
56_V	119_V	0.979	0.49
95_G	126_L	0.977	0.49
156_E	168_F	0.977	0.49
98_M	127_V	0.963	0.48
75_V	107_L	0.957	0.47
4_P	7_A	0.952	0.47
27_I	134_L	0.945	0.47
76_K	79_E	0.945	0.47
26_Y	34_S	0.938	0.46
161_L	165_L	0.936	0.46
72_V	75_V	0.923	0.45
127_V	134_L	0.916	0.44
170_G	177_S	0.914	0.44
138_C	169_S	0.909	0.44
54_R	142_N	0.908	0.44
43_D	46_R	0.896	0.43
157_L	166_V	0.885	0.42
7_A	18_L	0.882	0.42
81_Q	85_Y	0.880	0.42
148_L	154_E	0.879	0.42
8_C	18_L	0.877	0.42
19_R	22_V	0.873	0.41
7_A	38_R	0.873	0.41
28_K	43_D	0.867	0.41
4_P	15_Y	0.864	0.41
129_F	160_D	0.861	0.41
22_V	31_I	0.859	0.40
158_V	161_L	0.855	0.40
110_I	143_C	0.853	0.40
134_L	138_C	0.850	0.40
166_V	178_H	0.850	0.40
8_C	171_K	0.848	0.40
13_I	20_E	0.846	0.40
18_L	22_V	0.846	0.40
77_Y	149_N	0.843	0.39
78_L	143_C	0.842	0.39
171_K	175_M	0.836	0.39
85_Y	148_L	0.832	0.39
79_E	88_V	0.831	0.38
63_S	67_Q	0.829	0.38
155_E	158_V	0.824	0.38
39_F	43_D	0.823	0.38
42_E	73_N	0.822	0.38
161_L	174_G	0.821	0.38
81_Q	146_V	0.819	0.38
67_Q	73_N	0.815	0.37
3_R	33_Q	0.813	0.37
5_K	34_S	0.813	0.37
27_I	43_D	0.812	0.37
19_R	39_F	0.806	0.37
160_D	174_G	0.787	0.36
9_Q	68_K	0.784	0.35
30_V	38_R	0.780	0.35
118_V	145_I	0.774	0.35
153_K	175_M	0.769	0.34
73_N	162_M	0.758	0.34
97_N	141_H	0.756	0.33
157_L	160_D	0.736	0.32
14_S	22_V	0.736	0.32
108_R	140_A	0.735	0.32
76_K	80_E	0.731	0.32
139_K	171_K	0.730	0.32
121_A	166_V	0.730	0.32
84_E	119_V	0.729	0.32
175_M	182_K	0.723	0.31
19_R	31_I	0.720	0.31
91_D	145_I	0.720	0.31
10_R	90_T	0.719	0.31
70_E	121_A	0.716	0.31
14_S	172_L	0.710	0.31
87_L	100_R	0.705	0.30
81_Q	149_N	0.699	0.30
63_S	128_R	0.699	0.30
95_G	103_F	0.698	0.30
82_V	85_Y	0.696	0.30
54_R	143_C	0.695	0.30
19_R	36_K	0.692	0.29
100_R	127_V	0.691	0.29
6_E	43_D	0.689	0.29
147_V	165_L	0.680	0.29
6_E	157_L	0.675	0.28
160_D	164_V	0.675	0.28
64_S	73_N	0.669	0.28
57_I	150_Q	0.668	0.28
45_E	48_M	0.668	0.28
30_V	43_D	0.667	0.28
44_V	118_V	0.667	0.28
51_I	147_V	0.667	0.28
93_G	163_S	0.660	0.28
120_V	147_V	0.656	0.27
19_R	37_W	0.652	0.27
137_T	140_A	0.651	0.27
135_E	145_I	0.649	0.27
107_L	146_V	0.646	0.27
15_Y	37_W	0.645	0.27
120_V	143_C	0.640	0.26
178_H	182_K	0.636	0.26
56_V	116_S	0.627	0.26
85_Y	96_L	0.626	0.26
129_F	164_V	0.620	0.25
33_Q	113_N	0.620	0.25
48_M	51_I	0.617	0.25
26_Y	165_L	0.616	0.25
120_V	145_I	0.613	0.25
129_F	174_G	0.612	0.25
57_I	106_L	0.611	0.25
99_K	171_K	0.609	0.25
57_I	115_V	0.607	0.25
177_S	180_Y	0.605	0.25
118_V	171_K	0.604	0.24
29_P	39_F	0.603	0.24
161_L	164_V	0.598	0.24
119_V	134_L	0.595	0.24
157_L	168_F	0.595	0.24
92_I	101_K	0.593	0.24
77_Y	91_D	0.592	0.24
4_P	8_C	0.592	0.24
103_F	167_S	0.589	0.24
54_R	112_N	0.589	0.24
77_Y	163_S	0.588	0.24
53_K	57_I	0.585	0.23
34_S	113_N	0.584	0.23
12_G	129_F	0.584	0.23
13_I	16_A	0.582	0.23
119_V	136_E	0.582	0.23
110_I	147_V	0.582	0.23
92_I	145_I	0.581	0.23
103_F	127_V	0.577	0.23
85_Y	103_F	0.576	0.23
3_R	36_K	0.575	0.23
130_G	169_S	0.574	0.23
110_I	145_I	0.574	0.23
73_N	76_K	0.574	0.23
85_Y	121_A	0.571	0.23
96_L	133_I	0.569	0.23
8_C	12_G	0.569	0.23
5_K	25_G	0.569	0.23
99_K	141_H	0.567	0.23
111_L	137_T	0.567	0.23
92_I	100_R	0.566	0.23
13_I	31_I	0.563	0.22
181_E	184_K	0.562	0.22
31_I	36_K	0.562	0.22
169_S	175_M	0.560	0.22
123_P	165_L	0.558	0.22
16_A	26_Y	0.557	0.22
103_F	116_S	0.549	0.22
90_T	137_T	0.546	0.22
66_T	121_A	0.545	0.21
6_E	146_V	0.541	0.21
115_V	143_C	0.539	0.21
63_S	129_F	0.539	0.21
130_G	146_V	0.539	0.21
55_K	116_S	0.539	0.21
64_S	174_G	0.536	0.21
20_E	29_P	0.534	0.21
14_S	24_K	0.530	0.21
22_V	32_L	0.525	0.21
8_C	103_F	0.523	0.20
165_L	169_S	0.522	0.20
5_K	19_R	0.521	0.20
77_Y	178_H	0.521	0.20
107_L	114_E	0.521	0.20
16_A	20_E	0.518	0.20
93_G	97_N	0.518	0.20
46_R	122_Y	0.514	0.20
66_T	122_Y	0.513	0.20
99_K	162_M	0.512	0.20
6_E	10_R	0.512	0.20
4_P	21_Y	0.510	0.20
137_T	141_H	0.510	0.20
21_Y	157_L	0.510	0.20
134_L	157_L	0.507	0.20
51_I	116_S	0.507	0.20
23_K	101_K	0.505	0.20
6_E	120_V	0.505	0.20
3_R	37_W	0.502	0.19
81_Q	148_L	0.502	0.19
29_P	70_E	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ilxA	2	0.7188	100	0.647	Contact Map
3lhkA	2	0.7292	99.9	0.656	Contact Map
3g13A	2	0.7135	99.8	0.737	Contact Map
3bvpA	4	0.625	99.8	0.746	Contact Map
4bqqA	2	0.6979	99.8	0.747	Contact Map
3guvA	2	0.6875	99.8	0.748	Contact Map
2mhcA	1	0.5625	99.8	0.749	Contact Map
2gm5A	4	0.6146	99.7	0.757	Contact Map
3pkzA	4	0.5833	99.7	0.763	Contact Map
1gdtA	2	0.6875	99.7	0.763	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0078 seconds.